SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1SQL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SQL8
Domain Number 1 Region: 201-338
Classification Level Classification E-value
Superfamily TPR-like 1.46e-27
Family Tetratricopeptide repeat (TPR) 0.0026
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000206
Family FKBP immunophilin/proline isomerase 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1SQL8
Sequence length 349
Comment (tr|G1SQL8|G1SQL8_RABIT) FK506 binding protein like {ECO:0000313|Ensembl:ENSOCUP00000005402} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=FKBPL OC=Oryctolagus.
Sequence
METPPVLPVGEKDASPPQQPWEQDSRGNLASATQIRLQPPEPPTQSLQLGLSPDPASRRL
EHPRGTPTQLAGPEGGSDTSRGSPSEAPEPLRAPDLWRCPDGSFVKKIITRGRGLDKPKL
GSRCRVLACGFPLGSGPPEGWTELTIGMGPWREEAWGELVEKCLESMCQGEEAELRLPGH
SGPPAGLTLASFTPGRDSWQLQISEKEALAREERARGTELFRAGNPEGAARCYGRALRLL
LTLPPPGPPERTVLHANLAACQLLLGQPQLAVQSCNRVLEREPGHLKALYRRGVAQAALG
NLEKASADLKKVLAVDPKNRAAHEELEKVANREKKQKAGLAQGLRKMFG
Download sequence
Identical sequences G1SQL8
9986.ENSOCUP00000005402 ENSOCUP00000005402 ENSOCUP00000005402 XP_002714344.1.1745 XP_008260836.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]