SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1SRX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SRX9
Domain Number 1 Region: 44-252
Classification Level Classification E-value
Superfamily PHP domain-like 1.92e-43
Family RNase P subunit p30 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1SRX9
Sequence length 291
Comment (tr|G1SRX9|G1SRX9_RABIT) Ribonuclease P/MRP subunit p30 {ECO:0000313|Ensembl:ENSOCUP00000005961} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=RPP30 OC=Oryctolagus.
Sequence
MPRGGGLGGCAEECACGVSWDCSMAVFADLDLRAGSDLKSLRGLVETAAHLGYSVVAINH
VVDFKEKKQEIEKPIAVSELFTTLPIVQGKSRPIKILTRVTIVVSDPSHCNVLRATSSRV
RLYDIVAVFPKTEKLFHVACTQLDVDLVCVTVTEKLPFYFRRPPISVAIDRDLSFELVYS
PAIKDSTVRRYTISNALNLMQICRGKNVIISSAAERPLEIRGPYDVANLGLLFGLTENTA
KAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDDDSLPACKKAKCEG
Download sequence
Identical sequences G1SRX9
ENSOCUP00000005961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]