SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1SS37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SS37
Domain Number 1 Region: 434-922
Classification Level Classification E-value
Superfamily ALDH-like 6.54e-165
Family ALDH-like 0.000000000676
Further Details:      
 
Domain Number 2 Region: 23-223
Classification Level Classification E-value
Superfamily Formyltransferase 1.31e-49
Family Formyltransferase 0.0000000172
Further Details:      
 
Domain Number 3 Region: 227-327
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.04e-25
Family Post formyltransferase domain 0.0000155
Further Details:      
 
Weak hits

Sequence:  G1SS37
Domain Number - Region: 346-417
Classification Level Classification E-value
Superfamily ACP-like 0.0016
Family Acyl-carrier protein (ACP) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1SS37
Sequence length 923
Comment (tr|G1SS37|G1SS37_RABIT) 10-formyltetrahydrofolate dehydrogenase {ECO:0000256|PIRNR:PIRNR036489} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=ALDH1L2 OC=Oryctolagus.
Sequence
MLRGGGQALRRFSSSPISFKNKLKLALIGQSLFGQEVYNHLRKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKFPRWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDVIDGP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGLSVFWADDGLDTGPILLQRSCEVQPND
TVDTLYNRFLFPEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSSLLNSSVPPGEPLEIKGAKKPGLVTKNGLVL
YGNDGKALMVRNLQFEDGKMIPASQYFSAGETSVVELTAEEVKVAETIKLIWAGILSNVP
VIEDSTDFFKSGARSMDVVRLVEEIRQKCGGLQLQNEDVYLATRFEDFIQKVVRKLRGED
QEAELVVDYVSKEVNEMTVKMPYQCFINGEFTDADDGKTYDTINPTDGSTICKVSYASLV
DVDKAVAAAKEAFENGEWGRMNARERGRLMYRLADLLEEHQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSE
HPDIRKLGFTGSTLIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAV
FFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLL
QYCEAGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFQNGD
IDGVLQRANNTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSG
FGKDLGEEALNEYLKTKTVTLEY
Download sequence
Identical sequences G1SS37
XP_002711492.2.1745 ENSOCUP00000006025 ENSOCUP00000006025 9986.ENSOCUP00000006025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]