SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1SZ63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1SZ63
Domain Number 1 Region: 2-420
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-153
Family ALDH-like 0.00000000000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1SZ63
Sequence length 424
Comment (tr|G1SZ63|G1SZ63_RABIT) Aldehyde dehydrogenase 9 family member A1 {ECO:0000313|Ensembl:ENSOCUP00000008944} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=ALDH9A1 OC=Oryctolagus.
Sequence
MERCRILLEAARIMRERKDEIATVETINNGKSIFEARWDIDTSWQCLEYYAGLAASMAGE
HIQLPGGSFGYTRREPLGVCVGIGAWNYPFQIACWKSAPALACGNAMIFKPSPFTPVSAL
LLAEIYTAAGVPPGLFNVVQGGAATGQLLCQHQDVAKVSFTGSVPTGSKIMEMSAKGIKP
VTLELGGKSPLIIFSDCDMKNAVNGALMANFLTQGEVCCNGTRVFVQKEILDKFTEEVVK
KTQKIKIGDPLLEDTRMGPLINRPHLERVLGFIKVAKEQGAKVLCGGDLYVPEDPKLKDG
YYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFDTEAEVVERANNTTFGLAAGVFTRDIQR
AHRVVAELQAGMCFINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDV
ESTF
Download sequence
Identical sequences G1SZ63
ENSOCUP00000008944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]