SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1T276 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1T276
Domain Number 1 Region: 2-428
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-129
Family ALDH-like 0.0000000000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1T276
Sequence length 485
Comment (tr|G1T276|G1T276_RABIT) Aldehyde dehydrogenase {ECO:0000256|PIRNR:PIRNR036492} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=ALDH3A2 OC=Oryctolagus.
Sequence
MEREVQRLRRAFRSGRSRPLRFRLQQLEALRRMVQEREADILAAIAADLCKSELNAYSQE
VITILGEIDFMLNNLADWVTAKPVKKNLFTMLDEAYVQAEPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVILKPSELSEHTAQVLAKLLPQYLDQDLYAVVNGGVKETTELLKERFDH
ILYTGNAAVGRVVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDTVCRRITWGKYMNCGQT
CIAPDYVLCEASLQNHIVQKIKETVQEFYGENIKESPDYERIINLRHFKRIQSLLEGQKI
AFGGETDEATRYIAPTVLTDVDPEAKVMQEEIFGPVLPIVPVKNADEAIQFINEREKPLA
LYIFSHNDKLIRRMIDETSSGGVTGNDVIMHFTLNSLPFGGVGHSGMGAYHGKHTFDTFS
HQRPCLLKSLKGESANKLRYPPNSQSKVDWAKFFLLKQFHKGKLGLLLLAVLGIVAALLV
KTGYY
Download sequence
Identical sequences G1T276
XP_008248572.1.1745 ENSOCUP00000010232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]