SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1T9E1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1T9E1
Domain Number 1 Region: 196-273
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.22e-18
Family Middle domain of MutM-like DNA repair proteins 0.0053
Further Details:      
 
Weak hits

Sequence:  G1T9E1
Domain Number - Region: 2-62
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.0188
Family N-terminal domain of MutM-like DNA repair proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1T9E1
Sequence length 334
Comment (tr|G1T9E1|G1T9E1_RABIT) Uncharacterized protein {ECO:0000313|Ensembl:ENSOCUP00000013246} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=NEIL2 OC=Oryctolagus.
Sequence
MPEGPSVRKFHHLVSPFVGQQVVKTGGSSKKLHPPDLQSLWLQDTQVHGKKLFLRFDPDE
ELRLRGNDPLPEPLRKGAQEVEAADQEQAVGPSRQTASDKSSQAAALAVPPGDEGPKCLG
ADCLTPGAERWLQVSFGLFGSIWVNEFSRAKKANKRGDWRDPAPRLVLYFGGGGFLAFYN
CQMSWSSSPVVRPTSDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEVLY
RAGVHPLSLGSLLSPSCLEALVDHVVEFSTHWLQDKLQGRQQHPQIYQKEQCPAGHQVLK
QELGPPGGFQRLTWWCPQCQPRLPAEGPEQHQRA
Download sequence
Identical sequences G1T9E1
ENSOCUP00000013246 ENSOCUP00000013246 9986.ENSOCUP00000013246 XP_002709338.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]