SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1TF09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1TF09
Domain Number 1 Region: 378-506
Classification Level Classification E-value
Superfamily C-type lectin-like 4.56e-42
Family C-type lectin domain 0.0000877
Further Details:      
 
Domain Number 2 Region: 959-1110
Classification Level Classification E-value
Superfamily C-type lectin-like 1.3e-33
Family C-type lectin domain 0.00047
Further Details:      
 
Domain Number 3 Region: 234-367
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-33
Family C-type lectin domain 0.00046
Further Details:      
 
Domain Number 4 Region: 826-952
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-33
Family C-type lectin domain 0.00036
Further Details:      
 
Domain Number 5 Region: 517-652
Classification Level Classification E-value
Superfamily C-type lectin-like 8.94e-33
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 6 Region: 663-812
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-28
Family C-type lectin domain 0.00033
Further Details:      
 
Domain Number 7 Region: 1259-1404
Classification Level Classification E-value
Superfamily C-type lectin-like 1.35e-27
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 8 Region: 39-171
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.04e-25
Family Cysteine rich domain 0.0024
Further Details:      
 
Domain Number 9 Region: 1121-1249
Classification Level Classification E-value
Superfamily C-type lectin-like 2.19e-25
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 10 Region: 171-229
Classification Level Classification E-value
Superfamily Kringle-like 4e-20
Family Fibronectin type II module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1TF09
Sequence length 1479
Comment (tr|G1TF09|G1TF09_RABIT) Mannose receptor C type 2 {ECO:0000313|Ensembl:ENSOCUP00000015497} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=MRC2 OC=Oryctolagus.
Sequence
MGPGRPAPTPWPRHLLRCVLLLGGLHLGRPGAAAAVPPDPDVFLIFSQGLQGCLEALGGQ
VRVTPACNASLPAQRWKWVSRNRLFNLGTTQCLGTGWPGTNTTASLGMYECDREALNLRW
HCRTLGDQLSLLLGGRASNVSKPGTLERGDQTRSGQWHIYGSNEDLCARPYYEVYTIQGN
SHGKPCTIPFKYDSQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWDK
DQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYRSTLWNGLN
DLDTSGGWQWSDNSSFKYLDWRKDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKK
KPNATAEPSLPERWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRSGGDLLSIH
SMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDC
VTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGAADEDHGCRQGWTWHSPSCYWLGEDQVT
YSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNGTGSFCWLSGDEV
MYTHWNRDQPGFSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDP
TPSLTASCPQSWASDPKLRHCYKVFSSERLQDKKSWIQAQRACQELGAQLLSLASYEEEH
FVANMLNKIFGESEPEIHEQHLFWMGLNRRDPAAGQSWRWSDGLGFSYHNFDRSRHDNDD
IRGCAVLDLASLQWVAMQCETQLDWICKIPRGVDVREPDVSPQGRREWLRFQEAEYKFFE
HHSAWAQAQRICTWFQAELASVHSQAELDFLGHNLQKFSRGQEQHWWIGLHTSESDGRFR
WTDGSVINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYVCKRSNSTRETQL
PDLPPAAVGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQA
FITASLPNVTFDLWIGLHASQRDFQWVEQEPLLYSNWAPGEPSGPSPAPSGNKPTSCAVV
LHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAATPPAPGTELSYLNGTFRLLH
KPLRWQDALLLCESHNASLAHVPDPYTQAFLTQAARGLRTPLWIGLASEEGSQRYSWVSE
EPLSYVSWQDGEPQQPGGCAYVDLDGAWRTTSCDTKLQGAVCGVSRGPPPFRRVSYQGSC
PQGLADSAWIPFREHCYSFHMELLLGHKEALQRCQRAGGAVLSILDEMENVFVWEHLQSS
EGQSRGAWLGMNFNPKGGTLVWQDNTVVNYSNWGPPGLGPSMLSHNSCYWIQSSSGLWRP
GACANVTMGVVCKLPRGEPPAPPPTTALPENPAALVVVLMAVLLLLALLTAALILYRRRQ
SIERGAFEGARYSRSSTGPGEATEKNILVSDMEMNEQQD
Download sequence
Identical sequences G1TF09
ENSOCUP00000015497 ENSOCUP00000015497 9986.ENSOCUP00000015497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]