SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1TM29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1TM29
Domain Number 1 Region: 489-757
Classification Level Classification E-value
Superfamily ALDH-like 3.67e-40
Family ALDH-like 0.00068
Further Details:      
 
Domain Number 2 Region: 295-473
Classification Level Classification E-value
Superfamily ALDH-like 4.97e-36
Family ALDH-like 0.00027
Further Details:      
 
Domain Number 3 Region: 29-193
Classification Level Classification E-value
Superfamily ALDH-like 7.33e-30
Family ALDH-like 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1TM29
Sequence length 789
Comment (tr|G1TM29|G1TM29_RABIT) Aldehyde dehydrogenase family 16 member A1 {ECO:0000256|PIRNR:PIRNR036490} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=ALDH16A1 OC=Oryctolagus.
Sequence
MAATRVGPRACDIFTTMEYGPAPESHACALAWLDTQRHLGHYVDGKWLNPEHRSSVPCQD
PVTGENLATCLLAQAEDVCAAVEAARTSLESWSKLPGAARAQHLSRLAKMLQKHQRLLWT
LESLVTGRAVREVRDGDVSLAQQLLQYHAVQAHTQEEALAGWEPMGVIGLILPPTFSFIE
MMWRVCPALAVGESLSCPVPQAAPCPTAARRGRGPRGSPSFLEVGGVSVPRGPHLPFPSL
CASPHPTPPRCPGLAQSVSLALSLPLVFQLLSSPSEPHPPRVWASALCDPAGGLRLLIQE
SVWAETLRRLQARMGRLRSGRGLDGAVDMGARGAAARDLAQRYVREAESLGAQVFQAGDV
PSDGPFYPPTLVSGLPPAAPCAQAEVPWPLVVASPFRTAKEALAMANATPRGGSGSVWSE
RLGQALELGHGLQVGTVWINSHGLRDPGVPTGGCKESGSSWHGGPDGLYEYLRPPGTPAR
LPAPSENLNYDTFGLTVPSTLPAGPEAGPSPAPPYGLFVGGRFQAPGARSSRPIPGADGS
LHGYVAEGGAKDIRGAVEAAHQAAPGWVGRSPGARAAVLWALAAALERRAPTLTSRLERH
GVGLKAAKAEVELSARRLRTWGARAQAQGHSLQVAGLRGPVLRLREALGVLAIVCPEEWP
LLAFVSLLAPALAHGNALVVVPSGACPLLALELCQDMATLLPAGLVNVVTGDRDHLTRCL
ALHQDIQALWYFGSAQGSRFAEWASAGNLKAVWANAGHPRAWDQEAEGAGPELGLRAART
KALWLPAGD
Download sequence
Identical sequences G1TM29
ENSOCUP00000018035 ENSOCUP00000018035 9986.ENSOCUP00000018035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]