SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1TMB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1TMB9
Domain Number 1 Region: 29-146
Classification Level Classification E-value
Superfamily FKBP-like 3.93e-28
Family FKBP immunophilin/proline isomerase 0.00017
Further Details:      
 
Domain Number 2 Region: 168-317
Classification Level Classification E-value
Superfamily TPR-like 1.37e-21
Family Tetratricopeptide repeat (TPR) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1TMB9
Sequence length 327
Comment (tr|G1TMB9|G1TMB9_RABIT) Peptidylprolyl isomerase {ECO:0000256|PROSITE-ProRule:PRU00277} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=FKBP6 OC=Oryctolagus.
Sequence
MSGFARPRNGMAPSGEDCLSVYQRLSQRMLDISGDRGVLKDVIREGVGELVTPDASVLVK
YSGYLEHMDKPFDSNCFRKSPRLMKLGEDITLWGMELGLLSMRRGELARFLFTPTYAYGA
LGCPPLIPPNTTVLFEIELLDFLDSAESDTFCALSAEQQDQFPLQKVLKVAATEREFGNY
LFRQNRFCDAKARYKRALLLLHRRSAAPGEQHLVEAAKLLVLLNLSFTYLKLERPAPALC
YGEQALDIDNKNTKALFRCGQACLLMTEYEKARDFLVRAQKQQPFNHDINSELKKLASCY
KDYTDREREMCHRMFAPCADGPAMAQH
Download sequence
Identical sequences G1TMB9
ENSOCUP00000018127 ENSOCUP00000018127 XP_002722023.1.1745 9986.ENSOCUP00000018127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]