SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1U2M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1U2M8
Domain Number 1 Region: 144-197
Classification Level Classification E-value
Superfamily Kringle-like 1.14e-17
Family Fibronectin type II module 0.0013
Further Details:      
 
Domain Number 2 Region: 110-152
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000148
Family Fibronectin type II module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1U2M8
Sequence length 198
Comment (tr|G1U2M8|G1U2M8_RABIT) Uncharacterized protein {ECO:0000313|Ensembl:ENSOCUP00000023628} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=LOC103344941 OC=Oryctolagus.
Sequence
AMAVCWGLCLMWVCAWAFLQMDCVNAAPGLLSELLGLVDDSVVIATPGAESYKAKTIKAS
KITTTTPAATTATHKPTTSQIQNKPPPGLSSTPNAKNALSPGPPGQSDKKCVFPFTFGNK
KHFDCTVEGSIFHWCSLTDKYSGKWKYCTDDDRARCVFPFIFEGHVYKDCITKGSLFRMA
WCSLSPYYDHDKAWKYCY
Download sequence
Identical sequences G1U2M8
9986.ENSOCUP00000023628 ENSOCUP00000023628 ENSOCUP00000025332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]