SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1U9R6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1U9R6
Domain Number 1 Region: 1400-1572
Classification Level Classification E-value
Superfamily Fibronectin type III 1.27e-27
Family Fibronectin type III 0.00001
Further Details:      
 
Domain Number 2 Region: 859-1027
Classification Level Classification E-value
Superfamily Fibronectin type III 4.69e-26
Family Fibronectin type III 0.00053
Further Details:      
 
Domain Number 3 Region: 1856-2020
Classification Level Classification E-value
Superfamily Fibronectin type III 1.75e-25
Family Fibronectin type III 0.000012
Further Details:      
 
Domain Number 4 Region: 1584-1750
Classification Level Classification E-value
Superfamily Fibronectin type III 5.58e-24
Family Fibronectin type III 0.0000105
Further Details:      
 
Domain Number 5 Region: 1215-1389
Classification Level Classification E-value
Superfamily Fibronectin type III 2.26e-22
Family Fibronectin type III 0.00000868
Further Details:      
 
Domain Number 6 Region: 676-841
Classification Level Classification E-value
Superfamily Fibronectin type III 2.89e-22
Family Fibronectin type III 0.00077
Further Details:      
 
Domain Number 7 Region: 358-413
Classification Level Classification E-value
Superfamily Kringle-like 9.14e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 8 Region: 298-353
Classification Level Classification E-value
Superfamily Kringle-like 1.46e-20
Family Fibronectin type II module 0.0000586
Further Details:      
 
Domain Number 9 Region: 1761-1851
Classification Level Classification E-value
Superfamily Fibronectin type III 1.29e-19
Family Fibronectin type III 0.00000395
Further Details:      
 
Domain Number 10 Region: 1123-1212
Classification Level Classification E-value
Superfamily Fibronectin type III 6.09e-17
Family Fibronectin type III 0.00000315
Further Details:      
 
Domain Number 11 Region: 507-553
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000105
Family Fibronectin type I module 0.0017
Further Details:      
 
Domain Number 12 Region: 2290-2333
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000017
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 13 Region: 465-509
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000314
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 14 Region: 568-650
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000635
Family Fibronectin type III 0.00000348
Further Details:      
 
Domain Number 15 Region: 180-223
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000123
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 16 Region: 417-458
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000157
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 17 Region: 43-88
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000275
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 18 Region: 2245-2288
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000404
Family Fibronectin type I module 0.003
Further Details:      
 
Domain Number 19 Region: 134-177
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000615
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 20 Region: 91-131
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000353
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 21 Region: 2333-2374
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 22 Region: 2-40
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000017
Family Fibronectin type I module 0.00025
Further Details:      
 
Domain Number 23 Region: 2159-2222
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000328
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 24 Region: 256-294
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000523
Family Fibronectin type I module 0.00038
Further Details:      
 
Domain Number 25 Region: 1043-1130
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000168
Family Fibronectin type III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1U9R6
Sequence length 2427
Comment (tr|G1U9R6|G1U9R6_RABIT) Fibronectin {ECO:0000313|Ensembl:ENSOCUP00000008718} KW=Complete proteome; Reference proteome OX=9986 OS=Oryctolagus cuniculus (Rabbit). GN=FN1 OC=Oryctolagus.
Sequence
GCYDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGD
TYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCL
GNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNR
CNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHASLQTTSTGSGPFSDVR
AAVYQPQPHPQPAPYGHCVTDSGVVYSEGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQT
YGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQT
RGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEIC
TTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDDITYNVNDT
FHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETRTFYQIGDSWEKYVHGVRYQCYCY
GRGIGEWHCQPLQTYPGTSGPVQVIITETPSQPNSHPIQWNAPEPSHISKYILRWRPKNS
VGRWKEATIPGHLNSYTIKGLRPGVMYEGQLISIQQYGHREVTRFDFTTTSTSTPVTSNT
VTGETTPLSPVVATSESVTEITASSFVVSWVSASDTVSGFLVEYELSEEGDEPKYLDLPS
TVTSVNIPDLLPGRKYIVNVYQISEEGKQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVR
WSRPQAPITGYRVVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESA
PVFIQQETTGVPRSDEVPPPKDLQFVEVTDVKVTIMWTPPDSAVTGYRVDVLPVHLPGEN
GQRLPVSRNTFAEITGLSPGVTYYFKVFAVNHGRESRPLTAQQATKLDAPTNLQFVNETD
SSVLVIWTPPRARITGYQLTIGPTRGGQPKQHNVGPTVSKYLLRNLQPGSEYTVTLIAVK
GNNQSPKVTGVFTTLQPQSSIPPYSTEVTETSIVITWTPAPRIGFKLGVRPSQGGEAPRE
VTSESGSIVVSGLTPGVEYVYSIQVLRDGKERDAPIVNTVVTPLSPPTNLHLEANPDTGV
LTVSWEKSTTPDITGYRITTTPTNGQQGYSLEEVVHADQNSCIFENLSPGLEYNVSVYTV
KDDKESVPVSDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIP
IFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPSPTDLRFTNIG
PDTMRVTWAPPPSIELTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVS
SVYEQHESTPVRGRQKTGLDAPTGIDFSDVTPNSFTVYWTPPRAPITGFWIRHHPEHGVG
RPREDRVPPSRNSITLTNLNPGTEYVVSIVALNGREQSPPLIGQQSTVSDVPRDLEVIAS
TPTSLLISWEAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGADYTITVY
AVTGRGDSPASSKPISIDYHTEIDKPSQMQVTDVQDNSISVRWLPSSSPVTGYRVTTTPK
NGAGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTNIDRPKGLA
FTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYT
VSVVALHDDMESQPLIGTQSTAIPAPTNLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPK
EKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPVQGVITTLENVSPPRR
ARVTDATETTITISWRTKTETITGFRVDAIPANGQNPIQRIIKPDVRSYTITGLQPGTDY
KIHLYTLNDNAQSSPVIIDASTAIDAPSNLHFLATTPNSLLVSWQPPRAKITGYIIKFEK
PGSPPREVVPRPRPGVTEATITGLEPGTEYTIYIIALKNNQKSDPLIGRKKTDELPQLVT
LPHPNLHGPEILDVPSTVQKTPFITNPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRR
TTPPTTATPVKLRPRPYLPNVDEDIQIGHVPRGDVDYHLYPHVLGLNPNASTGQEALSQT
TISWTPFQESSEYIISCHPVGTDEQPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQR
RHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVTHYAVGEEWERLSESGFKLSCQCLGFG
SGHFKCDSSKWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDG
KTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGVEPSPDSSTGHSYNQYTQRYHQ
RTNTNVNCPIECFMPLDVQADREDSRE
Download sequence
Identical sequences G1U9R6
ENSOCUP00000008718 ENSOCUP00000008718 9986.ENSOCUP00000008718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]