SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2HSS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2HSS0
Domain Number 1 Region: 12-302
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.88e-45
Family Methylenetetrahydrofolate reductase 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G2HSS0
Sequence length 303
Comment (tr|G2HSS0|G2HSS0_9PROT) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome; Reference proteome OX=944547 OS=Arcobacter sp. L. GN=ABLL_0356 OC=Campylobacteraceae; Arcobacter.
Sequence
MFETLIQKLQEDRFLTLETTPQHEPSMHNIIERIKKFKLQDRVDGFSCTDNPLAKLKYNA
LFASLKLQTEFNKPVIATMSMRDRNKIALQSDLMGANDFDVRAILALTGDPAKMSDQPHA
KGVFEANSLMLLKIIKSFNYGMDMSGHPFKIEPKQIFPFAVTNSYAKNFSTLEKKMNLKI
QNGAVGIISQPVFDIENAKKLLESFNIAKEGVEGDKKKAQLIFGVFPVTKLRTALFLSAQ
VPGIHVPQFWIDALETAHNISEEEEYKVGMQLSQDLFRDLNKLHPKIHLMTANRFDVANE
IIS
Download sequence
Identical sequences G2HSS0
gi|384171171|ref|YP_005552548.1| WP_014473072.1.69177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]