SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2I058 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2I058
Domain Number 1 Region: 5-231
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.35e-30
Family Methylenetetrahydrofolate reductase 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G2I058
Sequence length 245
Comment (tr|G2I058|G2I058_KOMMN) 5,10-methylenetetrahydrofolate reductase {ECO:0000313|EMBL:BAK84316.1} KW=Complete proteome; Reference proteome OX=634177 OS=1693 / Kondo 51) (Gluconacetobacter medellinensis). GN=GLX_19040 OC=Acetobacteraceae; Komagataeibacter.
Sequence
MGLTAVELIPRDAETLLRDAGEVSRLFPDAQVINIPDLLRFPLRSWEAARLIRPIFPRVI
PHIRAIDIAPDAPLPGADDPALREVLVVQGDPPTDLRHRTYPNTSESVIARYRREAPHLA
VYAAFDPYRRAPYKEMQAIARKKEAGAAGFFTQPIFDMRMLDLCMNWLAGENVFWGISPV
IGPKSRSYWETTNHVIFPHDFDPTLEANIAFARQMMDVVTQAGGNTYLMPLRVNLERYLT
PLRRQ
Download sequence
Identical sequences G2I058
WP_014105834.1.85694 gi|347761125|ref|YP_004868686.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]