SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2IS94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2IS94
Domain Number 1 Region: 33-124
Classification Level Classification E-value
Superfamily YccV-like 9.94e-34
Family YccV-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G2IS94
Sequence length 136
Comment (tr|G2IS94|G2IS94_9SPHN) Putative DNA-binding protein {ECO:0000313|EMBL:BAK66254.1} KW=Complete proteome; Reference proteome OX=627192 OS=Sphingobium sp. SYK-6. GN=SLG_15790 OC=Sphingomonadaceae; Sphingobium.
Sequence
MKQSPNDKRNAIPPELAAALPGALGAAPRIAHARFRIGDTVRHRMFGFRGVVFDIDPVFA
NSEEWYEAIPVAARPPRDQPFYHLFADNGESSYVAYVSQQNLVADETGDPIDHPAIDALF
ERKADGGYALGASRWH
Download sequence
Identical sequences G2IS94
gi|347527964|ref|YP_004834711.1| WP_014075905.1.10870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]