SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G2LFU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2LFU0
Domain Number 1 Region: 45-193
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 5.18e-26
Family MJ1460-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G2LFU0
Sequence length 220
Comment (tr|G2LFU0|G2LFU0_CHLTF) V4R domain protein {ECO:0000313|EMBL:AEP11734.1} KW=Complete proteome; Reference proteome OX=981222 OS=Chloracidobacterium thermophilum (strain B). GN=Cabther_A0978 OC=Bacteria; Acidobacteria; Blastocatellia; Chloracidobacterium.
Sequence
MAINVADGGIKNYHNYFVPEDFLSRDPRTRTIRLRDGQRGVYASEDFITSLHAGLDEEVG
NASNLIMYKSGYEWGVSDMKRFAEKMRHEFGGGKLDIWKMNRKFVLESWWWPLTTEGWGA
WAIDFSFEKQGMVFVTIKNSAVAKAMEQVGKPVCYMYAGMFAGVFSVFDREERGGIEVQC
YSMGNDCCKFIIGSQKKVNAAEFWRREGASAKEIMEKLVD
Download sequence
Identical sequences G2LFU0
WP_014099472.1.73878 gi|347754686|ref|YP_004862250.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]