SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2LJW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2LJW7
Domain Number 1 Region: 908-1233
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 6.8e-128
Family Methionine synthase SAM-binding domain 0.00000000826
Further Details:      
 
Domain Number 2 Region: 8-400
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 2.22e-118
Family Homocysteine S-methyltransferase 0.00000636
Further Details:      
 
Domain Number 3 Region: 357-631
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 4.06e-88
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0024
Further Details:      
 
Domain Number 4 Region: 749-900
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 3.79e-45
Family Cobalamin (vitamin B12)-binding domain 0.00000166
Further Details:      
 
Domain Number 5 Region: 650-737
Classification Level Classification E-value
Superfamily Methionine synthase domain 3.14e-29
Family Methionine synthase domain 0.0000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G2LJW7
Sequence length 1234
Comment (tr|G2LJW7|G2LJW7_CHLTF) 5-methyltetrahydrofolate--homocysteine methyltransferase {ECO:0000256|PIRNR:PIRNR000381} KW=Complete proteome; Reference proteome OX=981222 OS=Chloracidobacterium thermophilum (strain B). GN=Cabther_B0129 OC=Bacteria; Acidobacteria; Blastocatellia; Chloracidobacterium.
Sequence
MSSPTTALLEQALRERILVLDGAMGTMIQSHKLQEADYRGERFASHTHDLKGNNDLLCLT
RPDIVEAIHRAYLEAGADIIETNSFNAQRISQADYGLEDLSYEMNLAAAQCARRAVEAFL
REDSSRPRFVAGALGPTNKTASISPDVNDPGARGTTFDELVAAYAEQAEGLLDGGVDLLL
PETTFDTLNLKAALFAIEEVFERRGQRVPVMASVTVADASGRTLSGQTVEAFLISVEHAP
LLALGMNCGFGAAEMRPHVEELAEKSPFYLICYPNAGLPNVFGGFDQTPDIMGELLRDFA
RHGWLNIVGGCCGTTPKHIAAIAAAVAGMPPRIPPKPSRYTRLSGLEALVIRPETNFVNI
GERTNVTGSAKFAELIRAERYEDALTIARQQVANGAQMIDVNMDEAMLDSVRAMTCFLNL
VVADPDIARVPIVIDSSKFHVIEAGLKCVQGKCVVNSISLKEGEAVFIEQARRIRRYGAA
VVVMAFDEIGQADTAARKIEICTRAYRILTEQVGFPPEDIIFDPNILAIATGIEEHANYA
VDFIEATRVIKQTLPGCKVSGGVSNLSFSFRGNNVVREAMHSVFLYHAIRAGMDMGIVNA
GQLAVYDEIPPDLLELVEDVVLNRHPDATERLIAFAESVKGAGKAAVKDEAWRQTSVEER
LKHALIKGNADYIETDVEEALQKYGAPLAVIEGPLMDGMNVVGDLFGAGKMFLPQVVKSA
RVMKKAVAVLLPYLEAEKKAAANGQTANGSGRRKVLLATVKGDVHDIGKNIVGVVLGCNN
YEVIDLGVMQPCDVILAKAREHNVDVIGLSGLITPSLDEMVHVAKTMTEAGFTVPLLIGG
ATTSKLHTAVKIAPAYSGTTVHVLDASRAVGVVGALTSHEQRQDFIAQNAAEQAALREEH
QSRLDRKHLLPLAEARARRPQLRFDAETVAVPEQLGVMTFDDVTLDALVPYIDWSPFFHT
WELRGRYPKIFDDPTIGERARELFDDAQRLLERIITERRLHPRGVFGLFPANAVGDDIEL
YTDETRTEVLTRFHTLRQQVERTDGKPNIALADFIAPKDTGRLDYIGGFVVTAGLGLDEL
CAAFDADHDDYHSIMAKALADRLAEAFAELAHKRVRDLWGYGRHETLTREDLIRERYRGI
RPAPGYPASPDHTEKRTLFALLGAEENAGVRLTESCAMWPASSVSGLYFAHPDAHYFAVG
LLGRDQIEDYAARKGWTVAEAERWLRPNLGYDPA
Download sequence
Identical sequences G2LJW7
gi|347756088|ref|YP_004863651.1| WP_014100872.1.73878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]