SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2MDR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2MDR9
Domain Number 1 Region: 1-265
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.89e-69
Family Phosphate binding protein-like 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G2MDR9
Sequence length 287
Comment (tr|G2MDR9|G2MDR9_HELPX) Menaquinone biosynthetic enzyme MqnD {ECO:0000256|HAMAP-Rule:MF_00996} KW=Complete proteome OX=1055530 OS=Helicobacter pylori SNT49. GN=HPSNT_00925 OC=Helicobacteraceae; Helicobacter.
Sequence
MISVAHSPDADDIFMYYAIKFGWIDCPIKNKTFHNIALDIETLNQEALKNTYDVSAISFG
LYPKIANDYALLPTATSFGNGYGPKLVKKKGVKLKKDFRVALSGEHTTNALLFKIYYKHA
RIAYMNFLDIEKAVLEEKVHAGVLIHENILDFHNELEVEKELWDVWKELIKVDLPLPLGG
MAIRRSIPLYRAILIKKALIKAVEVALKHQNLLSGMLLERSLIRVNTEQLQTYLSLYANE
TSTRLSEIQILAIDKLFELGYQHGFYASLLKTKDCLLTDEYLQYRFS
Download sequence
Identical sequences G2MDR9
WP_000626285.1.42851 gi|385226419|ref|YP_005786343.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]