SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2MGY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2MGY1
Domain Number 1 Region: 56-103
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000034
Family Myb/SANT domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G2MGY1
Sequence length 116
Comment (tr|G2MGY1|G2MGY1_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:AEN06071.1} KW=Complete proteome; Reference proteome OX=756883 OS=halophilic archaeon DL31. GN=Halar_2415 OC=Archaea.
Sequence
MFEKLEPPFELFVKPRSHIRKNLSSVHGRTLIATVGGSNVYAERETRRIARDFMDEPHIA
GRRVSVRQVYALVEVRDVNPETVADRYDLDVADVYHALAYYHDVCVYPEDSTDGTA
Download sequence
Identical sequences G2MGY1
gi|345005591|ref|YP_004808444.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]