SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2MKR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2MKR9
Domain Number 1 Region: 30-144
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000145
Family Tetracyclin repressor-like, N-terminal domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G2MKR9
Sequence length 376
Comment (tr|G2MKR9|G2MKR9_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:AEN05170.1} KW=Complete proteome; Reference proteome OX=756883 OS=halophilic archaeon DL31. GN=Halar_0653 OC=Archaea.
Sequence
MPRTQEYVVDLSADERAELNALLASGTHKTRVLTRARCLLHADDGLTDDEVSQAVGCHPT
TVGRYRKRYTEDGLAAITRRKADRIYERKLDGREEAHLIALACSDPPEGRSRWSLHLLAD
HFVGLTEIDVESISHETVRQILKKTQLHPHRSKSWVIKPENSAAFVCKMEAVLDLYHEPF
DPLRPVVCFDESNKELHQEVRDPLPARPGAVARYDYTYERNGTRNLFVMSEPLTGWRHIE
VTQRRRKQEFVQQMQSLVDDHYPDAECIRVVMDNLNTHQRYAFYEFLPPEEARRLLSKLE
FHFTPEHGSWLNMAEIEFSALWTECLDRRIPDAATLRSEVAAWERSRNEDKSPIDWQFTT
DDARIKLRQLYPVNHD
Download sequence
Identical sequences G2MKR9
gi|345004690|ref|YP_004807543.1| gi|345005478|ref|YP_004808331.1| gi|345005842|ref|YP_004808695.1| gi|345005928|ref|YP_004808781.1| gi|345007396|ref|YP_004810248.1| gi|345007396|ref|YP_004810248.1|NC_015955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]