SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2MM37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2MM37
Domain Number 1 Region: 2-246
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.14e-48
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00055
Further Details:      
 
Domain Number 2 Region: 260-450
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.7e-36
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G2MM37
Sequence length 464
Comment (tr|G2MM37|G2MM37_9ARCH) 5'-Nucleotidase domain-containing protein {ECO:0000313|EMBL:AEN05864.1} KW=Complete proteome; Reference proteome OX=756883 OS=halophilic archaeon DL31. GN=Halar_2183 OC=Archaea.
Sequence
MVRLLHYSDIENIYDDAERAGRFAGRLAELDGDDALVVGTGDNTAPGVVSLAARGRQALD
LVSVVGTTADTFGNHDFDYGPDETRALVEASENTWVSANVRDEDGGPFAAAEGAVPWTIA
EADGERVGFFGLTDPATDSINPQAAPITLTDPYEAAEQAVADLRAEGVDYVVALSHLGGG
DDELARRVDVDAVLGGHVHSIRTEFVGDTLCTRPGVNGHNFIEITLEGDEASTRVVDPSE
GPVHEELREALQRRREAAGLTEVVATAAEPFERTEETTFGGESRIGNFVADAYRAAGDAD
VGLQNGGGIREGHPLHGEVTLADLVSVLPFEEPVVVVELTGEELRRALSEADGERLDFGE
PHWWHAHLSGAELVWDDEANEIVEATVGGEPIDPDRRYRVATAEYLLHSDHEFPTIEERH
RAGELGIQHDVLAAHARDGGLEVAVEGRIEFVRRGADQQDAPAE
Download sequence
Identical sequences G2MM37
WP_014051641.1.75361 gi|345005384|ref|YP_004808237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]