SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2P9I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G2P9I8
Domain Number - Region: 88-163
Classification Level Classification E-value
Superfamily Prim-pol domain 0.00307
Family Bifunctional DNA primase/polymerase N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G2P9I8
Sequence length 293
Comment (tr|G2P9I8|G2P9I8_STRVO) Bifunctional DNA primase/polymerase {ECO:0000313|EMBL:AEM88308.1} KW=Complete proteome; Reference proteome OX=653045 OS=Streptomyces violaceusniger Tu 4113. GN=Strvi_9010 OC=Streptomyces.
Sequence
MTSTHLATLPPLRTALELAAAGLPVLPLRRGKVPFGNCRTCAKDARTGRAVCGGRPNMKE
AGPCQCPGPCHAWAATTTDPSVIASPAWASAWREAVTVAYHPGGAGLTVVDLDDTAALAW
ARQTLPATRIVPTTRGEHWIYQGAMRSVNAVRDGVDIKSTMAYARWLGPGTGTITALPDI
VRALAVKKPSTGRSAPQSIAMPAWAAGEGVCPHRTPAYLDRGIAMAEQRITEARSAVHTT
VYRTFLAVLSTHGRCGCLTEAHITRLFTAAQAKGESPRHCTDAWTNARTTLGL
Download sequence
Identical sequences G2P9I8
WP_014061762.1.85068 gi|345016234|ref|YP_004818588.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]