SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2P9R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2P9R8
Domain Number 1 Region: 7-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-78
Family Protein kinases, catalytic subunit 0.000000034
Further Details:      
 
Domain Number 2 Region: 452-511
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000101
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 515-577
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000144
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.018
Further Details:      
 
Weak hits

Sequence:  G2P9R8
Domain Number - Region: 585-644
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00116
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.019
Further Details:      
 
Domain Number - Region: 381-443
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0017
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G2P9R8
Sequence length 670
Comment (tr|G2P9R8|G2P9R8_STRVO) Serine/threonine protein kinase with PASTA sensor(S) {ECO:0000313|EMBL:AEM80062.1} KW=Complete proteome; Reference proteome OX=653045 OS=Streptomyces violaceusniger Tu 4113. GN=Strvi_0274 OC=Streptomyces.
Sequence
MEEPRRLGGRYELGSVLGRGGMAEVYLAHDTRLGRTVAVKTLRADLARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYVDGVSIPYIVMEYVDGSTLRELLHSGRKLLPERSLEMTT
GILQALEYSHRNNIVHRDIKPANVMLTRDGQVKVMDFGIARAMGDAGMTMTQTAAVIGTA
QYLSPEQAKGETVDARSDLYSTGCLLYELLTVRPPFVGDSPVAVAYQHVREDPQSPSTYD
PEITPEMDAIVLRALVKDPDYRYQSADEMRADIEAALEGQPVAATAALGAVGYGSEDQPT
AMLRPQNAGAGAQTSMLPPMRDDDGGFGYDERPDRGRGRGGSGKKSNLSTILLIVAGILV
LVGAIFIGKSLFGGGKNDGMVPVPNLVGKTIADAKSQGENGDFKIKNVGSKFCENADKDT
VCEQNPESGGEIKRYGVVELTMSKGPKPAARVEVPDVLNVQYASAKDQLEAKGFKVEQKT
QQSDQTAGKVIDQNPKGGKKVAKGATITLTVAEAQQKVTVPDVTTQKVADATAALQGKGL
KVQTQEVDNGDVEAGTVTDQTPKGGQEVLPGSTVTLTVAKAAAENVPVPNLGGQKLKDAK
KALQDLGLNVGNITGPQDDEATVVASQPGAGTQVPKGQSVNLITVAGQGNGGNGNGGGDG
GGIFGGQNGF
Download sequence
Identical sequences G2P9R8
gi|345007988|ref|YP_004810342.1| WP_014053586.1.85068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]