SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2PEQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2PEQ4
Domain Number 1 Region: 339-575
Classification Level Classification E-value
Superfamily PHP domain-like 2.88e-49
Family PHP domain 0.00042
Further Details:      
 
Domain Number 2 Region: 156-316
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.1e-43
Family DNA polymerase beta-like 0.0017
Further Details:      
 
Domain Number 3 Region: 4-82
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.0000000000000288
Family DNA polymerase beta, N-terminal domain-like 0.0029
Further Details:      
 
Domain Number 4 Region: 55-148
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.00000497
Family Achaeal helicase C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G2PEQ4
Sequence length 581
Comment (tr|G2PEQ4|G2PEQ4_STRVO) PHP domain protein {ECO:0000313|EMBL:AEM83535.1} KW=Complete proteome; Reference proteome OX=653045 OS=Streptomyces violaceusniger Tu 4113. GN=Strvi_3873 OC=Streptomyces.
Sequence
MARSNEEVEALLREYADLLLITGGDAYRARAYEKAARAIGGHAADISQFDAKALRDIPNV
GRSTADKVVEYLRTGTMPAVEEARAAIPAGVRELTAIPALGPKKAMILYEELEISSVDQL
AQAIEEHQLRDLKGFGPKSEENILHGIALMRAAGDRIPLDEAMDVADDIVAALSKVRGCR
RCAYAGSLRRMKETVGDVDILVAAEDSGPFMEAFTGLPLTAEVIAHGQKKTSIRTTKGLQ
VDLRVLPLDSWGAGLLYFTGSKAHNIRVRAIAVRHGLKLSEYGLFETKSGKSIASRSEED
VYARLGMDWIPPTLREDRGEVKAALEGQLPKLVTESDLRGDLHTHTNLTDGLEPLEDMIT
KAERRGYAYYAITDHAPKLYMQQMTEEKMLAQRERVRELDRGRGRGHTRLLHGVELNIDT
EGDVDWPPEFLEDFDVCVASVHTQFGMDRKAMTRRLVRACENPYVHVIGHPTTRLIGKRP
GIDADLDEVFAACARTGTALEINAHPDRLDLSDDNILRAKSYGVVFALDSDAHSTRDLDN
MRYGVGVAQRGWLTPDDIINTWPLTRLRRFLRKDKGQQPSP
Download sequence
Identical sequences G2PEQ4
WP_014057033.1.85068 gi|345011461|ref|YP_004813815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]