SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G2PWK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2PWK8
Domain Number 1 Region: 83-176
Classification Level Classification E-value
Superfamily Ribosomal protein L6 8.06e-35
Family Ribosomal protein L6 0.0000222
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 5.14e-30
Family Ribosomal protein L6 0.0000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G2PWK8
Sequence length 182
Comment (tr|G2PWK8|G2PWK8_9FIRM) 50S ribosomal protein L6 {ECO:0000256|HAMAP-Rule:MF_01365, ECO:0000256|RuleBase:RU003870} KW=Complete proteome OX=632516 OS=Caldicellulosiruptor lactoaceticus 6A. GN=Calla_1143 OC=Caldicellulosiruptor.
Sequence
MSRIGRKPIDIPSGVDVKIDGNVITVKGPKGTLTREIHPEMIVKIENNQIIVQRPSDERF
HKALHGLTRTLIANMVEGVTKGYEKVLEVVGIGYRAQKQGKKLILNVGYSHPVEIEEPAG
ITIEVPDQNRIIVKGIDKQQVGNFAANIRKVREPDPYLGKGIKYADEVLRLKEGKAGKGG
KK
Download sequence
Identical sequences E4SAR3 G2PWK8
gi|312793924|ref|YP_004026847.1| gi|344996410|ref|YP_004798753.1| WP_013432986.1.61561 WP_013432986.1.70627 WP_013432986.1.78124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]