SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G2SLH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2SLH2
Domain Number 1 Region: 4-304
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 9.81e-81
Family ADP-ribosylglycohydrolase 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G2SLH2
Sequence length 312
Comment (tr|G2SLH2|G2SLH2_RHOMR) ADP-ribosylation/Crystallin J1 {ECO:0000313|EMBL:AEN74711.1} KW=Complete proteome OX=762570 OS=Rhodothermus marinus SG0.5JP17-172. GN=Rhom172_2831 OC=Rhodothermaceae; Rhodothermus.
Sequence
MGEQSRFRGCLLGLAIGDALGTTLEFRRPGTFEPLTDMVGGGPFNLPPGYWTDDTSMALC
LAASLLECDGFDPVDQLRRYVRWWREGYLSSTGRCFDIGNTVRRALQRFEEIGEAFPGPT
DPWSAGNGSIMRLAPVPMFYFRNPQLAIEMAACSSQTTHGSREAIDACRYLCALILGALQ
GVPKAELLAPHYCPIPNYWEQHPLAERIDEVAAGSFKARQPPEIRGSGYVVHTLEAALWA
FYRSKTFEEGCLMVVNLGEDADTTGAVYGQLAGAYYGAQGIPEHWLARLAHRPLIEDFAD
RLYWRTLNDGAQ
Download sequence
Identical sequences G2SLH2
gi|345301806|ref|YP_004831000.1|NC_015970 WP_014072502.1.101848 WP_014072502.1.92079 gi|345301806|ref|YP_004831000.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]