SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G2Y140 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G2Y140
Domain Number 1 Region: 127-333
Classification Level Classification E-value
Superfamily Kelch motif 9.16e-40
Family Kelch motif 0.00046
Further Details:      
 
Domain Number 2 Region: 30-173
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 4.32e-21
Family Galactose oxidase, central domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G2Y140
Sequence length 344
Comment (tr|G2Y140|G2Y140_BOTF4) Similar to kelch repeat-containing protein {ECO:0000313|EMBL:CCD46355.1} KW=Complete proteome; Reference proteome OX=999810 OS=cinerea). GN=BofuT4_P119050.1 OC=Helotiales; Sclerotiniaceae; Botrytis.
Sequence
MIFPSIILALFTLSTALPQSPTDTNITNNPGSWHRLPPIPLYPRQEHTTVYLDPYIYILG
GIITSYSTSDPYPTTTLMQRFSLHTNTWTRAADLPLPLNHANAAILNGAIYLLGGLTPDP
NGIWIANPSCFRYDPSSDTWTQLFTSIPSSLQIGAAAVARRGNTIYLAGGLTYLNVSETY
QPSVSYFTAYTSGFERWTSLPALPQARDHAGTGFLGDNGPFYVIGGRAFGRDNVVDTNYM
YDFQKGKWSEKKKMPTPRGGVASAVVGEKIFVMGGEGNPESKSGVFEENEAYDTGRDQWR
SYAPMDVPRHGTSGVAVGNKIYVPGGGLTEGGDPTDYFSYFEVP
Download sequence
Identical sequences G2Y140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]