SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3I5B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3I5B4
Domain Number 1 Region: 638-893
Classification Level Classification E-value
Superfamily YWTD domain 1.03e-55
Family YWTD domain 0.00000617
Further Details:      
 
Domain Number 2 Region: 26-286
Classification Level Classification E-value
Superfamily YWTD domain 1.07e-53
Family YWTD domain 0.00000173
Further Details:      
 
Domain Number 3 Region: 337-567
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-50
Family YWTD domain 0.00000248
Further Details:      
 
Domain Number 4 Region: 940-1197
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-38
Family YWTD domain 0.0000681
Further Details:      
 
Domain Number 5 Region: 1328-1364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 1290-1326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1249-1289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 593-639
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000019
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 9 Region: 896-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family EGF-type module 0.018
Further Details:      
 
Domain Number 10 Region: 292-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000144
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1207-1259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000986
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3I5B4
Sequence length 1608
Comment (tr|G3I5B4|G3I5B4_CRIGR) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=10029 OS=Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). GN=I79_018658 OC=Muroidea; Cricetidae; Cricetinae; Cricetulus.
Sequence
MRSGPVGRDVCRSSCDPKLRCCGASPLLLFANRRDVRLVDAGGVKLESTIVASGLEDAAA
VDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAAQSIVISGLVSPDGLACDWVGKKLYWTDS
ETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGEAPRIERAGMDGSTRK
IIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSG
DTLYWTDWQTRSIHACNKWTGEKRKEILSALYSPMDIQVLSQERQPPFHTRCEEDNGGCS
HLCLLSPREPFYSCACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVL
QVGDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVA
RNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKIECA
NLDGRDRHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINIDGTKRRTLLEDKLPH
IFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCAD
GNGGCSHLCFFTPHATKCGCPIGLELLSDMKTCIIPEAFLVFTSRATIHRISLETNNNDV
AIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDW
MGKNLYWADTGTNRIEVARLDGQFRQVLVWKDLDNPRSLALDPTKGYIYWTEWGGKPRIV
RAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERMVIADDLPY
PFGLTQYSDYIYWTDWNLHSIERADKTSGQNRTLIQGHLDFVMDILVFHSSRQDGLNDCV
HSNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPSTFLLFSQKFAISRMIPDDQLSP
DLVLPLHGLRNVKAINYDPLDKFIYWVDGRQNIKRAKDDGTQPSTLTSPSQSLSPDRQPH
DLSIDIYSRTLFWTCEATNTINVHRLDGDAMGVVLRGDRDKPRAIAVNAERGYMYFTNMQ
DHAAKIERASLDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGANRL
TLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRVQGRVTHLTGIHAVEEV
SLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACA
TGEIDCIPGAWRCDGFPECADQSDEEGCPVCSASQFPCARGQCVDLRLRCDGEADCQDRS
DEANCDAVCLPNQFRCTSGQCVLIKQQCDSFPDCADGSDELMCEINKPPSDDIPAHSSAI
GPVIGIILSLFVMGGVYFVCQRVMCQRYTGASGPFPHEYVSGTPHVPLNFIAPGGSQHGP
FPGIPCSKSMMSSMSLVGGRGSAPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATD
PSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSTSRWKTSKYYLDLN
SDSDPYPPPPTPHSQYLSAEDSCPPSPVTERSYCHLFPPPPSPCTDSS
Download sequence
Identical sequences G3I5B4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]