SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3MX39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3MX39
Domain Number 1 Region: 233-488
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.24e-66
Family Eukaryotic proteases 0.000000269
Further Details:      
 
Domain Number 2 Region: 53-168
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-22
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3MX39
Sequence length 492
Comment (tr|G3MX39|G3MX39_BOVIN) Complement C1r subcomponent like {ECO:0000313|Ensembl:ENSBTAP00000054098} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=C1RL OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MSSSRCLVSKLRELSLGKPHSTRCPGNMWWFLLWGVLQAFPTQGSVVLLAQWLPQKLTSP
GYPEPYVKGQESSTDIEAPEGYVVRLLFQDFDLEPSPDCERDSVTVSWVGGMDLGQFCGQ
QGSLLGRPPGQKEFVSSGNSLRLTFSAPASEDKTPGFHKGFLALYQAVAVNYTQPINQAT
GGPKAIPTPGDNPTEIQSCCQEPYYEAKPSGTLTCTAQVPWKQTQKREEAPRCVPVCGRP
VVPISQTRESLGASRAELGSFPWQALTSIYGRGGGALLGDRWVLTAAHTIYPKDSILLGR
NRSAQVFLGHTDTDQMLELGRHPVRRVVVHPDYHQEEPHDFHGDIALLELERSVPLGPHL
LPVCLPDREALYRPGRWGYVSGFGVEMDWLSTKLKYSRLPVAPRAACEAWLRERQRPEAF
TDGMFCAGDQTRPQSVCQGDSGGAFVVWDDRTQRWVATGIVSWGIGCGEGYGFYTKVLDY
VDWIRGVMGEKD
Download sequence
Identical sequences G3MX39
ENSBTAP00000054098 ENSBTAP00000054098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]