SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3N5H3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N5H3
Domain Number 1 Region: 106-322
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.5e-49
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 447-522
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-17
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 3 Region: 313-479
Classification Level Classification E-value
Superfamily PH domain-like 1.09e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3N5H3
Sequence length 558
Comment (tr|G3N5H3|G3N5H3_GASAC) Neuronal guanine nucleotide exchange factor {ECO:0000313|Ensembl:ENSGACP00000000546} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MSAQRPSSHGADQDNANLRLPSNGAGSQTICHSLNIIKNIAFLYQEYRDTSKQQEIEQRR
QRENLSPEVPPGTLMDGSGVLSPPVLQLQLRNNAQSLSLWQNLEVVQASGLLTRLPQSEI
IMQEAMFELVTSEASYYKSLEILETHFLRNPDLINTLSQSDVHFLFSNIEEVMKASERFL
MDLEHRMEKSILISEVCDIVYHHAVEHFNVFIKYVINQVYQEKNYRRILEGNQAFREAMA
SLENHPRVRGLSFTSFLILPFQRITRLKLLVQNILKKAEENSEIEQNAIKAHQQLEQIVK
ECNEGVRKMSRTEELISIEKTLEFKSKSVPIISHSRWLLKKGEVQHMTGPKTSRTMRSRK
LYQPVYLFLFNNLLLVTKRSSSGDKFQVIDSCTRAMLRTEDLEDQGQLLANVFNLKLLEN
QEERAVNYMLKTSSMSEKLRWTCALTPNRRTRFMSTSAHQQDSPQVQCIHSYSSQEPDEL
SIETADVLNLLERTDDGWMMGERLHDGERGWFPCRLVEDILSKEVRAQNLREAFRIQQAQ
KGGGVLQTEARIGSRAAR
Download sequence
Identical sequences G3N5H3
69293.ENSGACP00000000546 ENSGACP00000000546 ENSGACP00000000546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]