SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3N653 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3N653
Domain Number 1 Region: 634-889
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-55
Family YWTD domain 0.00000412
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-53
Family YWTD domain 0.0000016
Further Details:      
 
Domain Number 3 Region: 333-571
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-52
Family YWTD domain 0.00000377
Further Details:      
 
Domain Number 4 Region: 937-1198
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-39
Family YWTD domain 0.0000512
Further Details:      
 
Domain Number 5 Region: 1327-1365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 6 Region: 1248-1288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000101
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 7 Region: 892-939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.019
Further Details:      
 
Domain Number 8 Region: 1289-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 590-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000995
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 10 Region: 288-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000536
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 11 Region: 1206-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000377
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3N653
Sequence length 1618
Comment (tr|G3N653|G3N653_GASAC) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MGVALRSLLLCSFCLLVRGVPLLLYANRRDLRLVDAAHEKTNATVVVGGLEDAAAVDYVY
SQGLIYWSDVSEEAIKRTVFNQSGASAVQTVVPGLASPDGLACDWLGSKLYWTDSETNRI
EVAELDGSSRKVLFWQELDQPRAIALDPERGYMYWTDWGEVPKIERAGMDGTNRSVIVDQ
EIYWPNGLTLDYGPGKLYWADAKHNFIHRADLDGSSRESVVKGELPHPFALTLYEDTLFW
TDWSTHSIHSCRKQTGDEQRVVHSHILSPMDIHVFSAKRQATVVSSHCSVNNGGCSHLCL
LSPMKPFYLCACPTGVQLLEDGKTCRDGATRMLLLARRTDLRHISLDTPDFTDVVLQVED
IRHAIAVDYDPVEGYVYWTDDEVKAIRRSRLDGADAQFLVTSQVNHPDGIAVDWIARNLY
WTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERANLDG
TERLVMVNTSLGWPNGLALDYEERKLYWGDAKTDKIEVMDMDGTGRRVLVEDMLPHIFGF
SLLGDFIYWTDWQRRSIERVHKRTAEREVIIDQLPDLMGLKATHVHESSGTNPCAESNGG
CSHLCLYKPQAVQCGCPIGLELIADMRTCIVPEAFLLFSRHTDIRRISLETNNNNVAIPL
TGVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKN
LYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDRAAM
DGTGRITLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGQDREVIADDLPHPFGL
TQYQDYIYWTDWSQRSIERANKTSGQNRTVIQGHLDYVMDILVFHSSRQGGWNACASTNG
HCSHLCLAVPVSGFVCGCPAHFSLNYDNKTCSAPTSFLLFSQKTAINRMVMDEQQSPDII
LPIHSLRNVRAIDYDPLDKHLYWIDSKQGVIRRALEDGNQSSTVVSSAAPGPGPGLQLYD
LSIDIYSRFIYWTSEVTNVINVTRTDGGRVGVVLRGEQDKPRAIVVNPERGYMYFTNLLD
RSPKIERAALDGTEREVLFFSGLGKPVALAVDNEVGRLFWVDSDLRRIESSDLSGANRIV
IADSNILQPVGLTVFGEHLYWIDKQQQMIERIDKTTREGRTKIQARIAYLSDIHAVHELD
MREYGKHPCTWDNGGCSHICIVKGDGTTRCSCPVHLVLLQNELSCGEPPTCSPEQFSCTS
GEVDCIPQAWRCDGYPECDDGSDEEDCPVCSEDEFQCDSRQCVDLRLRCNGEVNCQDRSD
ESKCEVRCPPDQFSCSSGQCIGKHKKCDHNTDCADNSDEIGCYPTEEPPPPSNNTIGSIV
GVVMALFVVGAVYFACQRVLCPQMKDDGETVTNDFVVHGPSSVPLGYVPHPASLSSSLPA
GMSRGKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGAYFPPILNPPPSPATVRSQ
YTMEFGYSSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRAPLRSAGIAKG
YASDLNYDSEPFPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences G3N653
ENSGACP00000000777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]