SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3NGN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NGN3
Domain Number 1 Region: 200-353
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-31
Family Third domain of FERM 0.0014
Further Details:      
 
Domain Number 2 Region: 89-199
Classification Level Classification E-value
Superfamily Second domain of FERM 7.59e-22
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 3 Region: 3-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.55e-19
Family First domain of FERM 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3NGN3
Sequence length 938
Comment (tr|G3NGN3|G3NGN3_GASAC) FERM domain containing 4Bb {ECO:0000313|Ensembl:ENSGACP00000004489} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MAEGRLCQVHLLDDRKLELLVQPKLLSYELLDLVSSHFNLKEKEFFGLAFFDEHGQRKWL
QTDRRVLDHDFLKKSGPVALNFLVRFYVENITQLKDIITVELFFLNAKSAVYNGFIEVES
ENVFKLAANALQQAAKGDYTSDENTRADLKKLPTLPTKVLKEHPSFAYCEDRVIEHYKQL
KGVSRGQAIVQYLTLVESLPTYGVHYYEVKDKQGIPWWLGISYKGIGQYDLQDKLKPRKL
YQWKQLENLYFREKKFAVEVNDPHSNRRAVTKRTFGQTGLLIHTWYASHSLIKTIWVMAI
SQHQFYLDRKQTKTKLGTARSVDEIAMDLTEHGGAKINRLGDAGLKNNLITASNGSLVST
GSADSEISEEQKKEKLSELRKKEIELQDILAKKTKELKKICLREAELTGKLPKEYPLSSG
ERPPQVRRRVGTTFKLDDLFPYNEDPFLRNLESRFALQKKIVEAAKKLANEAELCKTVKK
KRRRNCLDAMQKLQQIEDEMNQYRIKKGKKPTQRASVIIADELVRSDCSSLSSLPLDDDD
SDGVSQRPRSRSVQGSPQLSPMRSPGAEYEAERQGPPRDDHQNKNHSSPREVSSTHSSPY
KTLPRPARDPRSMPPTPVMTRNAYSSSQLRSEGSPHGFRHRSGSLEAQPRPRKDADSEKP
VFVLSPAHRSNSTEVLEDCSSYTSQSSLDYCGAAHSHYGTLDSRTSTMHRLHRKVEVYGN
TGSMPNLVQHHSGCSYSCENSAHYTPSAYYVTGYPCPDMEPYANGAYGYENDVEGHYNVN
PSYQINGYHGHDRFRNYSSERADSLSQNPYATMRPPRTREGPRNELLAKNMQKALVAEHL
KGWYHRSRGHREGGRGMLAGYDFDSGSQLSLGYQTMPAAFSHSSRTTSFSSVSSVESAGN
WRNQLAVGLTEYDAPDAAHCTHPGAPASPCNRSPSHTR
Download sequence
Identical sequences G3NGN3
69293.ENSGACP00000004489 ENSGACP00000004489 ENSGACP00000004489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]