SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3NND3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NND3
Domain Number 1 Region: 204-328
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-42
Family Third domain of FERM 0.00000082
Further Details:      
 
Domain Number 2 Region: 94-203
Classification Level Classification E-value
Superfamily Second domain of FERM 1.19e-35
Family Second domain of FERM 0.00000316
Further Details:      
 
Domain Number 3 Region: 480-568
Classification Level Classification E-value
Superfamily Moesin tail domain 5.36e-31
Family Moesin tail domain 0.0000356
Further Details:      
 
Domain Number 4 Region: 7-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.67e-23
Family First domain of FERM 0.0000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3NND3
Sequence length 568
Comment (tr|G3NND3|G3NND3_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000006847} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
KCSRNKSRQVNVRVTSMDAELEFSFQPNTTGKQLFDQVARTIGLREIWYFGLQFVDSKGF
ITWLNSEKKVMVQDVRKETPLQFKLKAKFYPEDVAEELIQDVTRRLFFLQVKEDILGEEI
YCPPETAVLLGSYAVQAKYGEQEKSALEPGYLSSERLLPKRVLEQHKLSKEQWEERIQVW
HEEHRSMLKEEAMIEYLKIAQDLEMYGVNYFEIKNKKGSDLWLGVDALGVNIYEKNDKLS
PKIGFPWSEIRNISFNDKKFIIKPIDKKAPDFIFYAPRLRVNKRILQLCMGNHELFMRRR
KADTIEVQQMKAQAKEERLQKKMERDQLDADDEALPVRGDDQESRERQSVALPPSSVDLL
EIHLYIKKVNGEQIHKKLPKYCKSQKELQEQLDRAMRLEEERRRVEQEAARLEAERMEAI
IAKEELARQAEDQIRSQEQLQAKEVEENLIKTKEELHSVRSSSNNEDNEGSDHESEENNT
YSAELQTQEVNNHHEEEERLTEAEKNQRLQEQLMALSSELSEARHDDKKTANDVLHAENV
RVGRDKYKTLRQIRMGNTKQRVDEFEAL
Download sequence
Identical sequences G3NND3
ENSGACP00000006847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]