SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3NQE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NQE8
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.99e-25
Family Ubiquitin-related 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3NQE8
Sequence length 141
Comment (tr|G3NQE8|G3NQE8_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000007564} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MQITLKTLQQQTIQIEIDPEQTVKALKEKIETERGKDNFPVSGQKLIYAGKILQDDTPIK
DYNIDEKNFVVVMVSKNTGLTTPSPELAEREAPKPSVQDSGSTSTAVPATTSAPVAAPAA
VPIPPEEAKEEPSADATEPQP
Download sequence
Identical sequences G3NQE8
ENSGACP00000007564 ENSGACP00000007564 69293.ENSGACP00000007564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]