SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3NR75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NR75
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.83e-30
Family Ubiquitin-related 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3NR75
Sequence length 105
Comment (tr|G3NR75|G3NR75_GASAC) Small ubiquitin-related modifier {ECO:0000256|RuleBase:RU361190} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSIRQIRFR
FDGQPINETDTPSQLEMEDEDTIDVFQQQTGGVSIEEGSLFGATS
Download sequence
Identical sequences G3NR75
ENSGACP00000007842 69293.ENSGACP00000007842 ENSGACP00000007842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]