SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3NVV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3NVV3
Domain Number 1 Region: 197-286
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 4.45e-21
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0014
Further Details:      
 
Domain Number 2 Region: 363-447
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000719
Family UBX domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3NVV3
Sequence length 453
Comment (tr|G3NVV3|G3NVV3_GASAC) UBX domain protein 11 {ECO:0000313|Ensembl:ENSGACP00000009472} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MSSPLSMLKKRRRAPLPDPASEQRRPGRAAGIRLQHVGVPPSDFELMSAMIRRVGLLERK
VMCQAKEIERKKDKRISLLEAKLRFPEDSESARDLSGRDSLERKCQRLQNRVSEMNSFLN
DYGLTWVGDGGSSDAGESEAPNIHRARSSNLTDSLFPFQGASVAPGFRMNFDLVQRRIVE
LNVLAGEGECFVRPTATGARLAKREPIQLGLYRDGIVMFDGPFRSYQERSTQRCMNDLMD
GYFPSELQERFPDGVPFEVHDRRDQEFISRAPWNKFPGEGKTIRESSHVSFSCLHPATGK
ESSTDRFLKQLPNVVVKAGRVIDIRDSLRAVLQRLIKIPIRPQQLIVKTEGITVINRRQI
SSPDRPSSDSDVIALKVRSEDGNRTYILKMRFSDTVGHLRRHLDEARGGGLPGYDIITAS
PRCCFDDDHRTLQSCGLTTNAMLLLRKRQHPLS
Download sequence
Identical sequences G3NVV3
ENSGACP00000009472 69293.ENSGACP00000009472 ENSGACP00000009472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]