SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3P1D7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3P1D7
Domain Number 1 Region: 319-628
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.08e-109
Family Mammalian PLC 0.000000702
Further Details:      
 
Domain Number 2 Region: 161-318
Classification Level Classification E-value
Superfamily EF-hand 1.08e-35
Family EF-hand modules in multidomain proteins 0.022
Further Details:      
 
Domain Number 3 Region: 648-773
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.79e-30
Family PLC-like (P variant) 0.00022
Further Details:      
 
Domain Number 4 Region: 31-143
Classification Level Classification E-value
Superfamily PH domain-like 2.99e-26
Family Pleckstrin-homology domain (PH domain) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3P1D7
Sequence length 1020
Comment (tr|G3P1D7|G3P1D7_GASAC) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
LQDGSKQRQVRKKTVSFSSMPSDRKINSTAACMAFMMEGCEMKKVRSNSRMYNRYFLLDP
DMHWLRWEPSKKDSEKAKLEIKGIKEVRLGKKTPVLRSNGLSDQFPDECAFSIIYGDNYE
SLDLVASTADVVSTWVMGLRYLVSYGRHTVNMVEPSQPSLRTSWIGSVFDLADMEKEGHI
DLFRATQIIKGLNPGMKESRIELKFKELQKAKDQYGEAINMDTFVEAYCELCTRPEIFFL
MVQFSSNKEFLDSKDLMLFVDVEQGVESVTEDMCRDIVQKFEPSAEGRERAYLSIDGFTH
YLLSSKCHIFDPQHKRVCQDMTQPLSHYYINSSHNASLLEDHFWGSSDISSYIRAIRMGC
RSIEVIVWDGPDNEPVVYVGSSVASHLAFSKVLDVINQYAFESSEYPLILCLVNHCCIPQ
QKVMAQHMKKILGDKLFVEPSNKEENYLPSPEKLKSKILIKGKRLPHNFTDAEGDVTDEE
EGLEMTRRVGADEKDQLNGIGFRRFRLCRELSDLVSLCRSVQFRDFETSRRDQKYWEICS
FNEVDANRFANEFPEEFVCYNKRFLSRVYPTPMRIDASNMNPQDFWKCGCQIVAMNYQTP
GLMMDLNLGWFRQNGNCGYVLRPAIMREEVSYFSANARDSLPGVSAQLLHIKIISGQNLP
KPRGSAAKGDVVEPYIYVEIHGIPADCAEQRTKTVSQNGDNPIFDESFEFQINLPELAVL
RFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLQSLTGEFLPNTTLFVHVAITNRRGGG
KAHKRGLSVRKGRKTREYATTKTTGIKVVDELFRASTQPLREATDLRENVQNAVVSFKEL
CGLTPAANMKQCILTVSTWLMNSERSLRVTVDLSETYPTMEAQGPMPELLRKVFNAYDTM
IQTSRTLIESADVVYYKLTQAQRAGLDFHEDLHRIGAKEGLKGRKLQKAMESYAWNITVL
KGQADLLKHAKSEALDTLRQIHCAAQSCGLSKNGASSPQLQHHPPHQVQMQQQPQAETHP
Download sequence
Identical sequences G3P1D7
69293.ENSGACP00000011410 ENSGACP00000011410 ENSGACP00000011410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]