SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3P2Q9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3P2Q9
Domain Number 1 Region: 148-349
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-50
Family DBL homology domain (DH-domain) 0.0000212
Further Details:      
 
Domain Number 2 Region: 346-469
Classification Level Classification E-value
Superfamily PH domain-like 4.51e-33
Family Pleckstrin-homology domain (PH domain) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3P2Q9
Sequence length 535
Comment (tr|G3P2Q9|G3P2Q9_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000011882} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MKGGHHHHRHHRGCGCQHLFRKVLVKCGCCYARLGRYSYSAAGSEGSISTSVASLPPQAS
GSSAPSSPGSRRSVSTLKKWLTNPVRKLSVGAKVTFYRAVISEMWLLSSPPVASFCLCPQ
DTQSTSVLPDDSSSVLMDDTSSQWSAVADTEEERRSALEKSMYVLQELIETEKHYVVDLG
LIVEGYMSTMHSKGIPEDMKGKDKIVFGNIHQIFDWHKDYFFGEVEKCIAEPERLAQLFN
KKERRLHMYVVYCQNKPKSEHIVSEYIETYFEELRQQLGHRLQLNDLLIKPVQRIMKYQL
LLKDFLKYYTKAGMDTEELEKAVEVMCFVPKRCNDMMNVGRLQGFEGKITAQGKLLQQDT
FTVTEQDSGFLSRAKERRIFLFEQLVIFSEPIDRKKGFSLPGYIFKNSIKVSCLGVEPSV
DGDDARFVLTARNPDASVVRFLLQASSPEICRAWFNDVVQILESQRNFLNALQSPIEYQR
RESKSNSLGRSMRPPLSAASALRPHSSASIDRHKLPSLHSHNTSLPTLYLPSQGQ
Download sequence
Identical sequences G3P2Q9
ENSGACP00000011882 69293.ENSGACP00000011882 ENSGACP00000011882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]