SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3P5G9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3P5G9
Domain Number 1 Region: 147-562
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.49e-132
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000279
Further Details:      
 
Domain Number 2 Region: 750-918
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.61e-58
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00012
Further Details:      
 
Domain Number 3 Region: 1-146
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 2.48e-40
Family Lipovitellin-phosvitin complex, superhelical domain 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3P5G9
Sequence length 984
Comment (tr|G3P5G9|G3P5G9_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000012842} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MALKVLGNAGHPSSLKPITKFLPGIGSAAADLPLRAHIEAVQAMRNIAKREPKMIQDMAL
QLFMDKALHSEVRMAAAIVLFETKLPMGLVITLANNLLTEKSLQVSSFVYSYMKSMTRNT
SPDLASVASACNVALRILSPKFDRLSYRFSRSLYVDTYNDPWMMGAAASAFYINDAATVL
PRSIVAKARTYLAGAYADVVELGVRTEGMQEALLKIKEVPENADRMTKMRQVMKALSEWR
ATPSSQPLASVYVKVFGQEVAFANVDKDVFNQLIQLASGPAMKSYGRESLDALLAGVTLH
YAKPLLLSEVRRIIPTSVGLPMELSLYTTAVAAASAEFKATVSPSLPADYQVAQLLKSDI
SMRTTISPSVSTHVYAVMGVNTAFLQAVLMSRAKVHTLLPAKLEARLDMIKGNFKLQLLP
LKGVSKIASARVETFAIARNVEDLAAAKITPMVPSAVEVSRGTFSSKMSRVASSVASSIS
ASSEILGGNAQSTLRSRAIQKRMCAESLTFGIKACSELQSRNATFIKDCPLYSMIGEHSF
LVEISPAAGPAVERIEIEIQVGEQAAEKIIKVINMSEEDDLLGDKNILMKLKKILAPGHK
NRTSSSSSSSSAKTSSSRSSKSSSASSKSSSSSSSSRRSKVSSSSSSSSSRRPSLSSRGS
SSNSSSSSSRRSKVSSSSRSSSNSSSSSSSSSSSSSRITYRTKQQLNAMNFTKDHIHQHA
DSRERANGKSSAHSFENIYNRAKYLSYTLNPAVTILIRAVRADDQVQGYQVAAYVDRANE
RLQIVFASLEQNNHWRICADGVKLSDHKLMAKLAWGLECKEYSTEITAETGRIGEDAAVR
MKITWEKLPESMKRFAKRLSDFLSRYTTRFGITQAKVQNVRNEIKLSVAAASEKTLNVVL
KTPKRTFYKLGITIPISLPIGDAAAELKPYENNLAAKFIYMITKANAAECSMVKDTLTTF
DKREHRIEMPHSCFQVMAQDCTEE
Download sequence
Identical sequences G3P5G9
69293.ENSGACP00000012842 ENSGACP00000012842 ENSGACP00000012842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]