SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3P5Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3P5Q0
Domain Number 1 Region: 626-1043
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.02e-117
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000105
Further Details:      
 
Domain Number 2 Region: 24-289
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.02e-87
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000011
Further Details:      
 
Domain Number 3 Region: 289-623
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 4.05e-84
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000181
Further Details:      
 
Domain Number 4 Region: 1190-1357
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.43e-61
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3P5Q0
Sequence length 1654
Comment (tr|G3P5Q0|G3P5Q0_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000012923} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MRGLVLALSLVFVAGHSQNSAPHFDAGKTYVYKYEALLLGGLPEKGLARAGLKISSKVLI
SSADQNIYMLKLLEPEIYEYSGFWPKDRLIPATKLTSALAAQLLTPIKFEYNNGTVGKIF
APDEISTMVLNIYRGILNVFQLNIKKTHTVYELQEAGVQGVCKTLYAISEDEQAERILLT
KTRDLNDCQEKVVKDIGLAYTEKCPKCQQDSKNLRGATAYNYVLKPAAHGILILEAAVNE
LIQFSPFAEINGAAQMETKQSLVFIGTQTIPIVPVVAQYVHRGSLKYEFSTELLQTPIQL
IKITNVQAQIGDVLNHLLAHTVESVHEDAPLKLLELIQLLRVARFEDLERIWSQYRTQPA
YRQWLLDTIPAIGSPAALKFIKVKYLADDLTVSEAAQAFIASVHMVTASAEAIKLVKALA
GNNKIVENPVLRKIVLLGFGTMISKYCVELDVCPAELIKPIQDLLAVAVAKDETEDIILL
LKALGNAGHPSSLKSIIKILPIHGTPAVSLPMRVHADAILALRNIAKKEPRMIQELALQL
YMDKALHPELRMLSCIVLFETRPPMGLVTTLANIVKTEKNMQVASFTYSHMKSMTRSTAV
IHASVAAACKVAVKILGPKLDRLNLHFSKAIHMDIYNNPLMLGAAASAFCINDAATILPR
SIVAKTSAYLAGAAADVLEVGVRTEGLQEVFMKNHALIDNVDRITKMRRVIKALSHWKAL
PNSTPLASVYVKFFGQEIAFANIDKVLIDQFIALTSGPSVGVMVRNAIKALLSGASSHFA
KPLLATEVRRIMPTAAGLPMELSLFTTAVAAAAIQVNAMVTTSLPENFHLIHLLRTDIKI
ETEIKPSVAVNTFAVMGVNTAILQATVLCRAKLNSFVPAKIVARLNINEGNFKVEVLPVF
MPEPIAAVHVETVAVARNIEDLAAARITPIIPAKVLHPISREIPKYDIFSSAASSLSKSS
EVYQDVAATITIVRPKQFQFVKKYCATALAIGLTGCIKLTTENAVSSRDVALYKLAAKRS
ISLSIKSIDGEEIERWEMEVQIGPKAAEKLIKHINPSEEIVEGRQGLMKLKKLLVPRQRN
VSSSSSSSSSSSSSSFSSRVSNKARKLSSSRAVSSSSSASSLASLFGVSSSSSSSSSRLS
KRVIYYHKFQKNHKIQALLSQVASVSKSRSSASSFEAIYKQNTFLGNEVAPIFAIIFRAI
RADKEMMGYELAVYLNKLTSRLQIILAALAADDTFKICAEGVLLSKHKVTAKLAWGAECK
QYNTMITAETGLLGQSPAARLRVAWDGVPSELKHYATKIYDYIPAAMLAGLIKGKDSNST
SQLSITVVATSDRTIDLIWKTPTRTVYKLALHLPISLPLNEIQGLTPFDGFADKVHYLLA
QAGSAECSVVRDTLTTFNNRRYKNEMPLSCYQVLAQDCTDELKFMVLMKKDHNEQKHINV
KISDIDIDLYSNITDVIVKVNGMEIPISNLPHHHLKAKIQIRPKGKGISVYAPSQGLQEV
YFDKNSWTVKVVDWMKGKTCGLCGMADGEVRQEYRTPNGRLTKHAVSYAHSWVLPALNCS
DTTECRMKLESVPLERQVNIHGQESRCYSVEPVLRCLQGCFPVRTTAVTIGFHCRPIDSD
LNCPESVSSINNKSVDLREKAEAHLACSCTAQCA
Download sequence
Identical sequences G3P5Q0
ENSGACP00000012923 69293.ENSGACP00000012923 ENSGACP00000012923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]