SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3P738 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3P738
Domain Number 1 Region: 31-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.65e-78
Family Calponin-homology domain, CH-domain 0.000078
Further Details:      
 
Domain Number 2 Region: 1336-1451
Classification Level Classification E-value
Superfamily E set domains 1.53e-35
Family Filamin repeat (rod domain) 0.0000136
Further Details:      
 
Domain Number 3 Region: 1068-1163
Classification Level Classification E-value
Superfamily E set domains 9.34e-32
Family Filamin repeat (rod domain) 0.00001
Further Details:      
 
Domain Number 4 Region: 469-575
Classification Level Classification E-value
Superfamily E set domains 1.93e-31
Family Filamin repeat (rod domain) 0.00099
Further Details:      
 
Domain Number 5 Region: 1537-1643
Classification Level Classification E-value
Superfamily E set domains 2.07e-31
Family Filamin repeat (rod domain) 0.00000712
Further Details:      
 
Domain Number 6 Region: 674-782
Classification Level Classification E-value
Superfamily E set domains 1.53e-29
Family Filamin repeat (rod domain) 0.00058
Further Details:      
 
Domain Number 7 Region: 1858-1953
Classification Level Classification E-value
Superfamily E set domains 2.74e-29
Family Filamin repeat (rod domain) 0.00000927
Further Details:      
 
Domain Number 8 Region: 1151-1257
Classification Level Classification E-value
Superfamily E set domains 1.87e-28
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 9 Region: 1247-1358
Classification Level Classification E-value
Superfamily E set domains 3e-28
Family Filamin repeat (rod domain) 0.0000223
Further Details:      
 
Domain Number 10 Region: 1429-1536
Classification Level Classification E-value
Superfamily E set domains 1.07e-27
Family Filamin repeat (rod domain) 0.0000519
Further Details:      
 
Domain Number 11 Region: 2044-2137
Classification Level Classification E-value
Superfamily E set domains 2.56e-27
Family Filamin repeat (rod domain) 0.0000264
Further Details:      
 
Domain Number 12 Region: 864-974
Classification Level Classification E-value
Superfamily E set domains 3.74e-26
Family Filamin repeat (rod domain) 0.00065
Further Details:      
 
Domain Number 13 Region: 759-875
Classification Level Classification E-value
Superfamily E set domains 7.34e-26
Family Filamin repeat (rod domain) 0.00069
Further Details:      
 
Domain Number 14 Region: 2320-2410
Classification Level Classification E-value
Superfamily E set domains 1.73e-25
Family Filamin repeat (rod domain) 0.00000904
Further Details:      
 
Domain Number 15 Region: 380-480
Classification Level Classification E-value
Superfamily E set domains 3.07e-25
Family Filamin repeat (rod domain) 0.00062
Further Details:      
 
Domain Number 16 Region: 566-668
Classification Level Classification E-value
Superfamily E set domains 4.67e-25
Family Filamin repeat (rod domain) 0.0002
Further Details:      
 
Domain Number 17 Region: 282-376
Classification Level Classification E-value
Superfamily E set domains 1.67e-24
Family Filamin repeat (rod domain) 0.00077
Further Details:      
 
Domain Number 18 Region: 2648-2737
Classification Level Classification E-value
Superfamily E set domains 6.41e-24
Family Filamin repeat (rod domain) 0.000012
Further Details:      
 
Domain Number 19 Region: 2511-2602
Classification Level Classification E-value
Superfamily E set domains 4e-23
Family Filamin repeat (rod domain) 0.00000896
Further Details:      
 
Domain Number 20 Region: 982-1083
Classification Level Classification E-value
Superfamily E set domains 1.73e-22
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 21 Region: 1634-1744
Classification Level Classification E-value
Superfamily E set domains 2.54e-22
Family Filamin repeat (rod domain) 0.0000934
Further Details:      
 
Domain Number 22 Region: 2252-2334
Classification Level Classification E-value
Superfamily E set domains 3.6e-21
Family Filamin repeat (rod domain) 0.00021
Further Details:      
 
Domain Number 23 Region: 2418-2507
Classification Level Classification E-value
Superfamily E set domains 1e-20
Family Filamin repeat (rod domain) 0.0000158
Further Details:      
 
Domain Number 24 Region: 1789-1873
Classification Level Classification E-value
Superfamily E set domains 5.07e-17
Family Filamin repeat (rod domain) 0.0000736
Further Details:      
 
Domain Number 25 Region: 1960-2040
Classification Level Classification E-value
Superfamily E set domains 2e-16
Family Filamin repeat (rod domain) 0.0000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3P738
Sequence length 2739
Comment (tr|G3P738|G3P738_GASAC) Filamin C, gamma a (actin binding protein 280) {ECO:0000313|Ensembl:ENSGACP00000013412} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MMSNNYDDQLPPQYYQGTDFGDEEDEEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
NKTVTDLQRDFTDGLKLISLLEVLSQKKMYRKSHSRPNFRQMKLENVSVALEFLDREHIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDDEDEEETKKLTPKQRLLGWIQNKV
PQLPINNFNRDWRDGKALGALVDNCAPGLCPDWSDWDPNKPVENAKEAMQQADDWLGVPQ
VIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGASLKPKQLFPNKAKAYGPGIEPHGNKVL
QPAVFTVDTLEAGSGEVLVYVEDPEGYKEEAKVKPNREKTGSYTVTYVPKVEGVHKVKVL
FAGQDIDKSPYTVNVARDMGDSSKVHARGPGLDTNGNVANKPTYFDIYTAGAGNGDVSVV
IVDPQGKKDTVELLLENKGDSVFRCTYRPMLEGPHTIHVLFGGQEIPRSPFTVNITEAIN
PNACRATGRGLQPKGVRVKEVADFKVFTKGAGSGSLSVSVKGPTGAEEQVKVREAGNGVY
ECEYYPLKPGKYTVSITWGGQPIPRSPFEVEVGKEAGFQKVRAWGPGLKTGMVGKSADFV
VEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEAGDYAVHVVCDDEDIKDSP
FMAHILPAANDVFPEKVKAYGPGLRPAGVIVNKPTEFTIDARMAGKGHLKIYAQDAEGCT
IDIKITDKGDGTFLCVYTPVKPMKHTIIITWGDVNVPSSPFRVLVGEGCHPDKVKVYGPG
VEKTGLKANEPTYFTVDCGEAGQALGDISIGIKCAPGVVGPAEADIEFDIIKNDNDTFTV
KYTPPGAGRYTIMVLFAEQEIPISPFKVKVDPSHDAGKVRAEGPGLNKTGVEVGTPTHFI
IYTKGAGKAKPGVNFAASGPGEAVRDFEIIDNHDYSYTVKYTALQQGNMAITVTHGGDPI
PKSPFHITVAPPLDIGKVKVEGLDTKVEVGKDQEFTVNTKGAGGQGNVGVKMTSPSGRPI
PCKLESDKAKGTHGVKYIPPEEGQYKVDVSYDGNPVMGSPFAVEAVMPADPSKVRAFGPG
LKGGIVGKPAPFTIDTKGAGAGGLGLTVEGPCEAKIECQDNGDGTCSVFYLPTEPGEYAI
NILFAEKHIPGSPFKAAVRPALDPSKVTASGPGLEKAKAGEPATFTVDCTRAGDAELTIE
IVSETGSKAEVHIQKTAEGTFSVTYIPPFHGTHTITIKYGGQMIPQFPKVLQVEPSVDTS
GVHVYGPGVEPRGVLREVTTHFIVDARALKKVGGNHVKVHIISPSGTTTETFITDKGDGT
YRVEYTAFEDGMHMIEVQYDEAPVPKSPFRVSVVEGCDPTRVRAYGPGLEGGITNKPNCF
TVETRGAGTGGLGLTIEGASEAKISCKDNKDGSCSVEYIPFTTGDYDVNINYGGHPIPGS
PFRVPVKDPVDPSKVKCSGPGLGGGVRAHVPQAFTADCTKAGQAPLDVKLYGPTGTVEPV
GVKNNGDGTHTVHYTPAQDGPYTVAVKYADQEVPHSSPFKVMSQPGHDASKVRASGPGLD
TKGVPASLPVEFTIDARDAGEGLLTVQILDPEGKPKNATIQDNRDGTYTVSYVPDSTGPY
TITIKYGGDEIPYSPYRIQSLPTGDASKCHLTVSIGGHGVSSLQKLQTSEDTVITVDAKA
AGKGKVTCKVQTPQGMELDMDVVENRDGTFDIYYTAPEPGKYVITIRFGGQNIPKSPFHV
VVSKGGFSQLPQLCAQSILVPMFCYALTWQASNEPVVPRDTVDPLFRPVNFLVPFMPQQG
EITGEVRMPSGKTGRPHITDNKDGTITIKYQPTERGLHEMDIKYDGNHIPGSPLQFFVDA
VNSGVVTAYGPGLSYGMVNRAATFTVVTKNAGEGGLSLAVEGPSKAEITCKDNKDGTCTV
SYLPTAPGDYNVIVKFDNKHISGSPFTAKVTGDDAITRTSQLNVGTAADVSLKIAETDLS
SLTASIRAPSGNEEPCLLKTLPNRHLGISFTPKEVGEHEVSVRKNGVHVANSPFKIMVGQ
SEIGEASRVKAFGKGLVEAHTLEMAEFFVDTRNAGYGGLALSIEGPSKVDINCEDVEDGT
CRVTYCPTEPGSYIVNIKFAEKHIPGSPFTVKVTGEGRMKESITRKRQASSIASVGSTCG
LNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQLGG
GGSPFRDVFGDFLGRESLSSFAGITARPEVAESGSQAMTAQVTSPSGKTVDADIVDGGSS
TYSVRFIPQEMGPHTVNVKYRDQHVPGSPFQFTVGPMGEGGSHKVRAGGPGLERGVAAAP
SEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDGSCGVSYIVKEPGDYEVSIKFNNEHI
PDSPFIVPIATLSDEARRLTVTSLQEKDLKVNQEASFMVQRNGARGVVDAKVHTPAGSSE
ECYVTELDSDKNAIRFIPRENGVHSIDVKFNGCHIPGSPFNVRVGDPGLVGDPGMVTAHG
PGLMGGTTGASSEFVVNTCNAGSATLSVNIDGPSKVKMDCRECPEGYKINYTPMAPGNYL
ITIKYGGPQHIVGSPFKAKVTGARLSGGHSLHETSSVLVETVTKTSKVGGAYSSSSSSST
TSTKLTSDASMVVCLGTGLSKAAVGQKNNFTVDCSKAGTNMLMVGVHGPHTPCEEVYVKH
MGNKLYNVTYTVKDKGNYTVIVKWGDDSVPGSPYKVVAS
Download sequence
Identical sequences G3P738
69293.ENSGACP00000013412 ENSGACP00000013412 ENSGACP00000013412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]