SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3P987 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3P987
Domain Number 1 Region: 197-509
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.2e-87
Family p120GAP domain-like 0.0000374
Further Details:      
 
Domain Number 2 Region: 72-178
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000238
Family Synaptotagmin-like (S variant) 0.027
Further Details:      
 
Domain Number 3 Region: 21-71
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000101
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3P987
Sequence length 1010
Comment (tr|G3P987|G3P987_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000014161} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
SCVSSLELRMDQSVIIKPVHSSLLGQDYCFEVTTSTGTKCFSCRSAAERDKWMENLRRAV
HPNKDNSRRVENILTVWVIEAKDLPAKKRYFCELCLDDCLYARTSCKLKTDNIFWGERFD
FGSLPSVTSITLHLKDTDRKRKKDKSSYVGLNIPVAMVTGRQLVEKWYSLSTPSTIRAKS
SVPTVRVKARYQSIVILPMEQYKEFAEYISSNYLLLCNTLEASISLRSKEELASALVHIL
HSTGKAKDFLTDLMMSEVDRCRDNDQLIFRENTLATKSIEEYLKLIGQKYLQDALGEFIK
ALYESDENCEVDSSRCATSDLAEHQANLRMCCELAFCKILDSYRFFPRELKEVFASWRQE
CCNRGRPDISERLISASLFLRFLCPAVMSPSLFDLMQEYPDERSARTLTLIAKVIQNLAN
FSKFGTKEEYMLFMNDFVERQWSSMQRFLQEISNPDGLNHTAGFDGYIDLGRELSSLHTL
LAELDQQACLSKLGPLPRIIREVSVALANPGGVSMSSPEPQHSTALTDGSDLQSRGSRML
VEAHNLSRLVDFTRLPSPTPENKDLFFVTKGSCLQPTSGQQGSPAVSSSYSEPNENEAGF
EMANGSRREGPDLTNESRSLSLVDLQDSSPSDGLDDGQWQLRTGLLPLSFQNPVYHMTAT
SPRQPMDATPSDGSAGSQGNPEDRNTIATKPAFLTQIDELCRTHSQVRQMMSSCCWPSGC
PAPSRQTTSGPQRRIDQPPPPSCAPPGPPRGRTPPSLLSGGAGIIHPTRPTSGSMMSSSP
DWPSSGQSRLRQTSSSSKGDSPEKQRPTAKVLRAALTMAPSPCALDRTAAWLLNMNSASS
YGEAEDDRHDDALVEKQYQQEIALLQEKLRVAAMRQDECEARLLVQDQQNQRMLQEYQVR
LEDTEGRLRRLQDDKDLQMNSIISRLMAVEEELKKDHSDMQAVVDSKQKIIEAQEKRISS
LDAANSRLMAAVTQLKERYAVTSQRNGLSPSNASSLQITENGEFRNSGNS
Download sequence
Identical sequences G3P987
69293.ENSGACP00000014161 ENSGACP00000014161 ENSGACP00000014161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]