SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3PCT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PCT8
Domain Number 1 Region: 29-156
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-37
Family Pleckstrin-homology domain (PH domain) 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PCT8
Sequence length 1159
Comment (tr|G3PCT8|G3PCT8_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000015412} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MNGKVNNPSERITHSKSANMVSDLSTETQPYTRTSRTPRTAATFGKRSNSMRRNPKAEVT
KHGWLHKQASSGVKQWNKRWFVLTDRCLFYYKDEKEDTVLGSLPLLSFQIKGVEPSDNIT
RKFAFKAQHAGTRTYYFSADSHEEQKEWIKAMNEAAEVNIQQTQRMNTIEDPNHTMATKA
TNQQTQQPPHTQRHCDTDIENTPHPKINVLNSPETPTPSTPCSKQAGKNTDGRKGEGEVE
GEGPVPDNASHPSHHPNGWGSHSQHCAPQGHPGGGVSPSYDPTEQQDNVVLRRGFVPRTA
PERVAQRKTSMVQLQQWVNHRRTMASQEDIHSLSSYYPVNHGVLDDYFGYPGGPPYMEEY
PLYPPGMRPDSICSVSALGGYNRRWTFEEKRHSLRDRSQLYGSTMPRDQWAPTYCGGMET
SMRRLSIQPRSRSVPRSPSLSSGGPYSPVPHNFASPARSTSGCFNRFPGRMREDVIYADP
SVYSLRRSLSPPKYDCPGYRRSLSQGLYNYNYPVTPSIRNKMTQEDILDLQLQRNLDYLD
QQSLGDLVSLTVTFNLPQKTKNPRQCSLSQVPPFYEVFSRELHPTLKLNEIETSKLLSRL
CEQNGIWKEHEAVVHRLRMEKDSLEEALVITHQELELFHTQPLALDKLRLKKDTLQNQLV
NIRGQLSQASSALTTSRMEFEALEDEANAIHGDLWEQLNAGGQSELVHRHIQKEFWRVQD
VLEGLHKNNSSRGTDTAKHKGITGRTVASGASGSFSPLSSVSFTSPLSPFSPVPGSQSPP
PNSWARSQEESVPPRPPLPKSYHPLEPSLTFPPSIPPLPFDSTAWLRSLGIDDGYLDGED
SQNRKVFGCFCFHPPLASPSPNYKMQSGFAEQNISDVQDQSQDRQSTMNKVGIVPPRTKS
PTDKSHSSSTGDTVHNGRCTNGILRFSTQERPKSAVFPAELKSKMSVEEQNERIRRHQSS
SVRDKRRSLNLSGGQSPANYKVIRRRLTAHEIDINDLEAAVRGQGQESPREEIARLRRLR
IEPEAHNLGSSKELVTSNKVVIPERYMDVEEYAPLSPEEQKEKQKKLVRIKTLIAKSNLQ
NMVPLLDGPGGAGAPVNSQQQMQEQEKRMEISCALAAEASRRSRLFSAQCAPSPPSSPSS
PDPPPSSADFPNSAHVLKS
Download sequence
Identical sequences G3PCT8
ENSGACP00000015412 69293.ENSGACP00000015412 ENSGACP00000015412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]