SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3PG76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PG76
Domain Number 1 Region: 18-265
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.73e-26
Family Tryptophan biosynthesis enzymes 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3PG76
Sequence length 274
Comment (tr|G3PG76|G3PG76_GASAC) Zgc:162297 {ECO:0000313|Ensembl:ENSGACP00000016600} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
TMKFLDLFGRLKSVVIGMIHVNALPGTPMGYMTMPQITEEACREAEIYRQAGIDGLIIEN
MHDVPYCFSVGPEVCACMTAVCAAVRGVCPRLPLGVQILSSANQQAVAVALASGLDFIRA
EGFVFSHVADEGLLDACAGDLLRYRKQIGAERVQIFTDIKKKHSSHALTSDVSIEETARA
AEFFLSDGLIVTGAATGAPADPRELRDVSQRVSIPVLIGSGVTYDNVERYLHASGMIIGS
HFKEGGRWAAAVDPEQVKRFMGKVRGLRTRGNAA
Download sequence
Identical sequences G3PG76
69293.ENSGACP00000016600 ENSGACP00000016600 ENSGACP00000016600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]