SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3PHQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PHQ3
Domain Number 1 Region: 21-162
Classification Level Classification E-value
Superfamily PH domain-like 2.61e-53
Family Ran-binding domain 0.000000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3PHQ3
Sequence length 216
Comment (tr|G3PHQ3|G3PHQ3_GASAC) RAN binding protein 1 {ECO:0000313|Ensembl:ENSGACP00000017129} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=RANBP1 OC=Gasterosteus.
Sequence
MADPKDQEDHETTAENAEESNHDPHFEPIVSLPEQDVKTLEEDEEELFKMRAKLYRFASE
NDPPEWKERGTGDVKLLKHKERGTIRLLMRRDRTLKICANHHIVPTMELKPNAGSDRAWV
WNTLADYADESPKAELLAIRFLNAENALKFKGKFDECKEEVRKSLEGTGDPDSANKVAEK
LEELTVKDKASDDKKEVQKVTEKKEDEKKENTAEEN
Download sequence
Identical sequences G3PHQ3
ENSGACP00000017129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]