SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3PMA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PMA6
Domain Number 1 Region: 52-298
Classification Level Classification E-value
Superfamily BEACH domain 4.05e-102
Family BEACH domain 0.0000000799
Further Details:      
 
Domain Number 2 Region: 419-694
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.93e-35
Family WD40-repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  G3PMA6
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily PH domain-like 0.0148
Family PreBEACH PH-like domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3PMA6
Sequence length 708
Comment (tr|G3PMA6|G3PMA6_GASAC) Neurobeachin-like 1 {ECO:0000313|Ensembl:ENSGACP00000018737} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
EIFLIDQTNYFLNFKKEVRNKVYSRMLLLRSLSLYGTRSPQELLKASGLTQFPWILADYT
SEELDLSDPRVFRDLSKPVAVLNERNAKAVREKYESFEDPTGTIDRFHYGTHYSNAAGVM
HYLIRVEPFTSLHIQLQSGRFDCADRQFHSIPATWQTLMDNPNDVKELIPEFFYFPEFLE
NQNGFDLGRLQISKERVNDVILPKWAKSPEDFIYKHRKALESEYVSAHLHEWIDLIFGYK
QRGPAAVEALNVFYYCTYEGAVDLDAITDEKERKALEGMISNFGQTPCQLLKEPHPVRLP
LEEVEKRKAQLDSCHFSMFEHLSDLKSFFVEGISDNVPLVKAVVPKNQSHSFITQGSPDT
LVTVSQNCLVGTHGWLPYNKNISNYFTFIKDPTVFNAKTQRFLSGPFAPGVEVTAGLFVA
SHDGKLLFSGGHWDNSLRVTSLVKGKTVGQHIRHMDIVTCLSTDHCGIHLISGSKDTTCM
VWQVLQQGGAPVGLHPKPVQVLYGHTDEVVSVSISTELDMAVSGSRDGTVIIHTVRRGHY
MRCLRPPCDSSLPLSILHLAVSWEGHLLVHTCLEGKATLKDKNSLHLYSVNGKHLRSEPL
KEQVTDMCVSGEYVVIGSEEGYLSIRDLYSLSLCAEPMAMRVPVRCVSVTKEQSHVLVGL
EDGKLIIVGVGKPAEMRSGQITRKLWGSSKRMTQISSGETVYNTQHDH
Download sequence
Identical sequences G3PMA6
ENSGACP00000018737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]