SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3PNF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PNF4
Domain Number 1 Region: 29-123
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-21
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 2 Region: 142-207
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.72e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PNF4
Sequence length 243
Comment (tr|G3PNF4|G3PNF4_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000019137} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
FLFTQDNRERIRAVENSFGPSGKPLYEPGRFLLGEGRLVKMTRKGPQPRRFFLFNDLLVY
GSIIFCWHRKQVIIPLEDSQLEDLENELSIKNQWLIRTPRKSFYVAAASQEEKRAWIQQI
EDCRSILLQNRGCRTSSHFANTWIPDSASAICMRCFDRFSVTQRRHHCRKCGFLVCAACS
KTRAVIQHIHPTKCWRICIGCHSNSSTRTTEEAQQVCHECHTERRSSDGEDGSSEEEEAE
ERM
Download sequence
Identical sequences G3PNF4
ENSGACP00000019137 69293.ENSGACP00000019137 ENSGACP00000019137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]