SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3PQM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PQM3
Domain Number 1 Region: 202-294
Classification Level Classification E-value
Superfamily TAFH domain-like 5.36e-34
Family TAFH domain-like 0.00000625
Further Details:      
 
Domain Number 2 Region: 574-622
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000745
Family TBP-associated factors, TAFs 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3PQM3
Sequence length 778
Comment (tr|G3PQM3|G3PQM3_GASAC) TATA-box binding protein associated factor 4 {ECO:0000313|Ensembl:ENSGACP00000019908} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN=TAF4 OC=Gasterosteus.
Sequence
MQIAARSPSVLQNPRPSLAPPGGTRAIAPQVLAPRLTQPQQATPNIQNIQLPPGMVLVRS
ESGQLLVIHQQTLAQMQAQSQSQSAMTPRAAAPTSTPPVQIASLQAPGASPLARPVAPTA
IIKQGSAVQATVTPTTTLQRPPILQVTLMCLNRVHTQPGKEPLGTPTPVQAGPAATQRAT
GTPVTPTAVTAVRRAPFVCMCLQETLENVKKCRNFLSTLIKLASSGKQSSETIANVKELV
KNLLEAKIEPEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQMTPDSESFIQQSLLPQPA
AATSTALTAVVLRPPVSTASSSPAATKTTVISLTQTPPSKPALVILCCGSASHSSASDCA
QQHGTLVRPQVALAQSPMGTLRGQPHSRIVVSHPQVVKQQPTGVSLCLLYKVNLTDFCLC
ASVTHPAMKQTLAQGAKGLQVVSQASLIAAQRNKLKEAGGGTFRSVTRSEKLHSAVLNVM
QGYKSPWSLCIVHEGESPAVIKQRVLPAAGLLNLNVSHTKRCKLCHCVLSRDDDDINDVA
SMAGVNLSEESDRILATNSELVGAVTRSCKDEAFLSTALLARRALEIGRKFGVSELGPDA
ANFIAHATQQRLRHLLERVSLVAQHRNGTFKEDERCEQASDVRTQLRFFEQLDKAAKVRI
LAQRHMTSSAAGSRSRQEDPEQLRLKQKAKEMQQQELAQIRQREANLTALAAIGPRKKRK
MDSPVRGASAEPGGSGGSGSRQFTRQRITRVNLRDLLFCLENERGTSRSHLLYRGFLK
Download sequence
Identical sequences G3PQM3
69293.ENSGACP00000019908 ENSGACP00000019908 ENSGACP00000019908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]