SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3PR31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PR31
Domain Number 1 Region: 27-107
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000447
Family Ubiquitin-related 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3PR31
Sequence length 445
Comment (tr|G3PR31|G3PR31_GASAC) Uncharacterized protein {ECO:0000313|Ensembl:ENSGACP00000020066} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MSAQRGGAGECGGGAGECGGHTNTDELGVEPTMRLSITSTAGGPVELTVPRGESVEGLRA
QISHRLRLQTDRIVLLYRDTQLTAGQLLDLGVTDGSKLTLVPAIEAGLVCSAARGERTMM
DVLESLTEVQVSSMSFGLCATAGVKKRELWRMPFPTVLQISDFLSGRSPLTVNLGIGAHM
MYVQLQLSAQNVAELQHHQDLRAGASGDLQAGLPTGARSRPAQSTPTPPPVISTPPLPSG
QQPAAAPVRSHAPTGSAPGPRCPASASTPREGDIPASSAAERSKQPGAVIESFVSPSPGV
LSGTFTGTLAPCGQRGFSHPRRGIGIILQIFNDLIRAAYNHQGSQPVPPRNPDGPDSNPP
GGVLLPAAEGTRQAEGQTPATQKAKLLRQTQGEESQLTGAPTQENQTLHYKLERLQLLMN
QRRLRRQTRRYLQTSRPYRHHQHRL
Download sequence
Identical sequences G3PR31
ENSGACP00000020066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]