SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3PSV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3PSV7
Domain Number 1 Region: 114-305
Classification Level Classification E-value
Superfamily PH domain-like 1.45e-34
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 2 Region: 6-75,106-146
Classification Level Classification E-value
Superfamily EF-hand 0.000000977
Family Calmodulin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3PSV7
Sequence length 588
Comment (tr|G3PSV7|G3PSV7_GASAC) SWAP switching B-cell complex 70a subunit 70a {ECO:0000313|Ensembl:ENSGACP00000020693} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
MWLREELLKSIWHAFTALDVDHRGKVSKSQLKVLSHSLCTVMKIPHDPVALEEHFKDDNK
GPLSNQGYMPYLNKFILDKVHGEFDLVEFNKICWLLCYKKNICTKRLLFSEDKAFKVWCI
FNFLSEDKYPLVIVTEEIEYFLQRLSEAMGSGWSEEKFADYKLQLHTKNNCLTAWELIEL
LGMGYFSHGLNSQILSMGITEVFQELILDVLKQGYMMKKGHKRKNWTERWFVLRPNSLSY
YVCEDLLEKKGDIILDRTCCVESLPDKEGKKCLFIIKCMDKSFEISASDKKKKQEWLQAI
QTCIRLLRLGLSSPHREARLRRKELRQRQQAEEDDVSERMRQLQVVNENKQRQLEGMRRK
IDAAAAEAAMEDHRRKQTELELQDRHRLDLEREKMVRQQMEEQVAQKSCELDQYLQRVRE
LEDMYHRLEGALEDERQAKQDEEAMRRLQARLLEEEAAKRAELEQIHLQQQRALSQTEAE
KQELVAEQRAKERDLQAAMLQLETLERERHGALEQYEKMSMKLERATNKTKTWKDKVAKH
EGLVRLIQPGHKGPQRITNWGPASFTDAELELRKKSWQESKNQGAAAQ
Download sequence
Identical sequences G3PSV7
69293.ENSGACP00000020693 ENSGACP00000020693 ENSGACP00000020693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]