SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G3Q322 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3Q322
Domain Number 1 Region: 767-915
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.58e-38
Family Regulator of G-protein signaling, RGS 0.0000807
Further Details:      
 
Domain Number 2 Region: 1104-1203
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.03e-27
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 9-97
Classification Level Classification E-value
Superfamily PDZ domain-like 4.26e-21
Family PDZ domain 0.0082
Further Details:      
 
Domain Number 4 Region: 255-376
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-20
Family Phosphotyrosine-binding domain (PTB) 0.0094
Further Details:      
 
Domain Number 5 Region: 1050-1118
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000245
Family Ras-binding domain, RBD 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3Q322
Sequence length 1431
Comment (tr|G3Q322|G3Q322_GASAC) Regulator of G protein signaling 12b {ECO:0000313|Ensembl:ENSGACP00000024271} KW=Complete proteome; Reference proteome OX=69293 OS=Gasterosteus aculeatus (Three-spined stickleback). GN= OC=Gasterosteus.
Sequence
IYGQQEVPRHDVQPGRIRAVEVARGRTGYGFTLSGQGPCVLSCVLKGSPADYVGLRSGDH
ILSVNDINVSKASHEDVVKLIGRCSGVLKLVIAEGERHRRHHDSCSSDDELDGFYGNGCG
ARGGWSKPKLDSKQLGINRAEKVVAELQSGGIFNMIFENSSQSSSSSDKDRPGPSSSSKP
RPRSNPEFPPYRNASRSQSNPNLLSEQEMAQVLNDDSVFLDADFSHLHLQQQEQDLDVGD
GGDLGLEHSEGILNVGMIVGYLGSIELASIGTSLESDSLQAIRCSMRRLRAEQKIHSLVL
MKVMHDSVRLCSDRGQVLATYPAEKLAFSACCPDDRRFFGLVTMQATDDHDDRHFSNGRD
EEGSLRTSCHVFIVDPDLCPHQVHLGVARRFGFECTPDPDTGGCLEFPPSSQPLLQFVSI
LYRDMGDNIEGVRARAFHDPDNDAQQNHSTSSNSDSGIGNFLPEEKSNRVLLVDIGGPPN
HNHVSGPRHWDSPPSSQQAWSPTLGAAATHPPPPPLPALRNGHYRHEPHLADLPHPLPLA
HPDVPGRHSRGVHPHHYSPGKRGGAVGGGEKRGGGGVGAGVEPQRWLPVHVLRDWRHHQN
HLQGLSSDQESYAESTDGWSSANCSTLPPPMSKIPADRYRAPLAAGDHLPPPPPPHPHSH
THRLAAQKDEWAKKLFGAGERAGAQRGEREKKRGNAKEGEKKGGRFRGLTMGFPPLPQRS
PARRSFGRSKRLSLARSLDDLQSTAVSDGELNSVELQGCSSDNSLNSNASLPSVQSHRRH
TERRVASWAVCFERLLQDPVGVRYFSEFLKKEFSEENILFWQACEFFSQVPENDKKQLSQ
RAREIYNSFLSSKATTPVNIDSQAQLADDILNAPRPDMFKEQQLQIFNLMKFDSYTRFLK
SLLYQECMLAEVEGRPLPDPYHIPSSPNSKHSTTGSDRSNLSTPKKVTEDKKSKSGRSLN
DDSREDSGDRRKGMFFSWSRNRSFGKGPKKRELTDFNYNFSGSNGRRESQGSLSSGASLE
LGTSGLGKNEGDVSRGAVSVSTECSAPLRQCNISLPDGSCCSVPLRAGVSIRDLLLGLCE
KLCINLAAIDLFLVGGEKPLVLDQDCMTLCSRDLRLEKRTLFRLDLVPINRSVGLKAKPT
KPVTEVLRPVVAKYGLHLADLVARISGELEPLDLGLPISNLDGLRVVLDIAENAPGKDKL
KTAPSKGLAPASTRGNQSTTGEIRPSGKAGSVHPHGAPEKRKQKKINIDEAEEFFDLISK
AQSNRADDQRGLLNKSDLQLPDFLRLSPVASNPNNGSFPGSGRQGNKVNVNDRGLCSLNA
SHQSQSLDSALGAERGGGRKVGPPPPFPGTVSPIRPTQGAQRGLLQDSIQMLEEDTLSDL
TLVGEGDIDSPSLNYVTPSALQCPTASTGRSARLRYFPCHTAWQRSGSDTM
Download sequence
Identical sequences G3Q322
69293.ENSGACP00000024271 ENSGACP00000024271 ENSGACP00000024271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]